KEGG   Rhodomicrobium vannielii: Rvan_0647Help
Entry
Rvan_0647         CDS       T01353                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00020  Citrate cycle (TCA cycle)
rva00640  Propanoate metabolism
rva00660  C5-Branched dibasic acid metabolism
rva01100  Metabolic pathways
rva01110  Biosynthesis of secondary metabolites
rva01120  Microbial metabolism in diverse environments
rva01130  Biosynthesis of antibiotics
rva01200  Carbon metabolism
Module
rva_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rva_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rvan_0647
   00640 Propanoate metabolism
    Rvan_0647
   00660 C5-Branched dibasic acid metabolism
    Rvan_0647
Enzymes [BR:rva01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rvan_0647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADP69924
UniProt: E3HZX3
Position
725994..727193
Genome map
AA seq 399 aa AA seqDB search
MNVHEYQAKAILKEYGVPVPKGHAAFTPEEAFAVAKELGGPIAVVKAQIHAGGRGKGSFK
EPEAGEKGGVRIAKSFDDVRTFADEMLGRTLVTVQTGPEGRVVKRLLIEEGAAIKRELYL
SFLVDRATSRVAVIASTEGGMDIEEVAHDAPEKILTFSIDPASGYSQFHGRKVAFELGLE
GDQVKQCVKLIGSLYKAFVEKDMSQLEINPLIVTEKGDLVCLDAKLNFDSNALYRHPEIV
ALRDLEEEDPAEVLASRYDLSYVKLDGSIGCLVNGAGLAMATMDIIKLYGSEPANFLDVG
GGATKEKVTEAFKIILSDPNVKGILVNIFGGIMRCDIIAEGIIAAAREMSLKVPLVVRLE
GTNVELGKEIIRNSGLAVIPADNLADAAEKIVAEVKKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttcacgaatatcaggcgaaagccatcctgaaagaatacggcgtacctgtgccg
aagggccatgccgccttcacaccggaagaagccttcgcagttgcgaaggaactcggcggc
cccatcgccgtcgttaaggcgcagatccatgccggcggtcgcggcaagggctcgttcaag
gagccggaagcgggcgagaagggcggcgttcgcatcgccaagtcgttcgacgatgtccgc
accttcgcggacgaaatgctcggccgcacgctcgtcaccgtgcagaccggccccgagggc
cgcgtcgtgaagcgcctcctcatcgaagagggcgcggcgatcaagcgcgaactctatctc
tctttcctcgtggaccgcgcgacgagccgcgtggccgtgatcgcctcgaccgagggcggc
atggacatcgaggaagtggcgcacgacgcccccgagaagatcctcaccttctccatcgat
ccggcgtcgggctattcgcagttccatggccgcaaggtggccttcgaactcggcctcgaa
ggcgatcaggtcaagcagtgcgtgaagctgatcgggagcctctacaaggctttcgtcgag
aaggacatgagccagctggaaatcaatccgctgatcgtgaccgagaagggcgacctcgtc
tgtctcgacgcgaagctgaacttcgactcgaacgcgctctaccgtcatcccgagatcgtg
gcgctgcgcgaccttgaagaggaagacccggcggaagtgctcgcgtcccgctatgacctg
tcctacgtgaagctcgacggcagcatcggctgcctcgtgaacggcgccggactcgccatg
gcgacaatggacatcatcaagctctacggttcggagcccgccaacttcctcgacgtcggc
ggcggcgcgacaaaggagaaggtgacggaagccttcaagatcatcctgtccgacccgaac
gtgaagggcatcctcgtcaacatcttcggcggcatcatgcgctgcgacatcatcgcggaa
ggcattatcgccgccgcccgcgagatgagcctcaaggtgccgctcgtcgtgcgcctcgaa
ggcacgaacgtcgaactcggcaaggagatcatccgcaattccggtctcgccgtgatcccg
gcggacaacctcgcggacgcagccgagaagatcgtggccgaggtgaagaaggcggcttga

DBGET integrated database retrieval system