KEGG   Rhodomicrobium vannielii: Rvan_2001Help
Entry
Rvan_2001         CDS       T01353                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00900  Terpenoid backbone biosynthesis
rva01100  Metabolic pathways
rva01110  Biosynthesis of secondary metabolites
rva01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rvan_2001
Enzymes [BR:rva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Rvan_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom Semialdhyde_dh Sacchrp_dh_NADP Epimerase NmrA adh_short DapB_N
Motif
Other DBs
NCBI-ProteinID: ADP71236
UniProt: E3I1E5
Position
2184035..2185285
Genome map
AA seq 416 aa AA seqDB search
MTKNGQAHELNGAGYRKRVSVLGATGTIGDSTCDLLAQNPDRFEVVALSANRNAKKLASL
AVQFKAKFAAVADESAGAELRDLLAGTGIECGAGKSAVVDAGARDADVVMASIVGYAGLA
PTLAALKQGRTVALANKECLVCAGAYFMNERERYGTTLLPVDSEHSAVFQSLEQEGRYVE
KIVLTASGGPFRTWTKEQIAAARVEDALKHPNWTMGQKITIDSATLMNKGLEIIEAFHLF
KVRADQLDAVVHPQSIIHALVYYTDGSVIAQASVPDMRTPIALSLAWPERLKAETIKRLD
LAEAATLTFEKPDETRFPALRLAKEVLKSGGNTPTVLNAANEVAVEAFLNRQISFPGIAE
AVERTLDMATSALAGVLPDSLDAVTHIDERARDIAKSALSSARPAVTIAEAAAPRI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaacgggcaggcacacgaattgaatggggcgggttaccgaaagcgcgtaagc
gtgctgggtgcgaccggcaccatcggcgacagcacctgcgatctcctcgcacaaaacccc
gaccggttcgaggtcgtggcgctgtcggcgaaccgcaacgcgaaaaagctcgcgagcctt
gccgtgcagttcaaggcgaaattcgcggcagtcgccgacgaaagcgcgggcgctgaactg
cgcgacctgctcgccgggacggggatcgaatgcggcgcgggcaagtcggcggtggtcgat
gccggtgctcgcgatgccgatgtcgtgatggcgtccatcgtcggctatgcgggcctggcg
cccacgctggcggctctgaagcagggccggacggtggcgctcgccaataaggaatgtctc
gtctgcgccggcgcttatttcatgaacgagcgcgagcgctacggcacgacgctgctgccg
gtcgattcggaacattcggccgtgtttcagtcgcttgagcaggaagggcgctacgtcgag
aagatcgtgctcaccgcttcgggtggtccgttccgcacatggacgaaggagcagatcgcg
gcggcgcgcgtcgaggatgcgttgaagcatccgaattggacgatggggcagaaaattacc
atcgacagcgccacgctcatgaacaagggcctcgaaatcatcgaggcgttccacctcttc
aaggtgcgcgccgaccaactcgatgccgtggtgcatccgcagtcgatcatccacgcgctc
gtctattacaccgacggctcggtgatcgcgcaggcgagcgtgcccgatatgcgcacgccc
atcgcgctgagccttgcctggccggagcggctcaaggcggaaaccatcaagcggctcgac
cttgccgaggctgccacgctcaccttcgagaagcccgacgagacgcgcttccccgcgctc
cgcctcgcaaaggaagtgctgaagtccggaggcaacacgccgaccgtgctcaacgcggcg
aacgaggtggcggtggaagccttcctgaatcgccagatttccttccccggcatcgccgag
gcagtcgaacgcacgctcgacatggcgacgtccgcgctcgccggcgtgctgccggatagt
ctcgacgccgtcacccatatcgacgagcgcgcccgtgatatcgccaaatcggcgctcagc
tccgctcgtcccgccgtcacgatcgcggaagcggcggctccgcgtatttaa

DBGET integrated database retrieval system