KEGG   Rhodomicrobium vannielii: Rvan_2137Help
Entry
Rvan_2137         CDS       T01353                                 

Definition
(GenBank) fructose-bisphosphate aldolase, class II, Calvin cycle subtype
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00010  Glycolysis / Gluconeogenesis
rva00030  Pentose phosphate pathway
rva00051  Fructose and mannose metabolism
rva00680  Methane metabolism
rva00710  Carbon fixation in photosynthetic organisms
rva01100  Metabolic pathways
rva01110  Biosynthesis of secondary metabolites
rva01120  Microbial metabolism in diverse environments
rva01130  Biosynthesis of antibiotics
rva01200  Carbon metabolism
rva01230  Biosynthesis of amino acids
Module
rva_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
rva_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rva_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
rva_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rvan_2137
   00030 Pentose phosphate pathway
    Rvan_2137
   00051 Fructose and mannose metabolism
    Rvan_2137
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rvan_2137
   00680 Methane metabolism
    Rvan_2137
Enzymes [BR:rva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Rvan_2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: ADP71362
UniProt: E3I2K3
Position
complement(2331592..2332656)
Genome map
AA seq 354 aa AA seqDB search
MARITLRQLLDHAAEHGYGVPAFNINNMEQGIAILEAAKETDSPVIIQASRGARSYAGDL
LLGKLVEGLEVQYPTIPICMHQDHGNNEETCASAIRLGYDSVMMDGSLKADGSTPADYDY
NVRITSDVTRMAHYVGVSVEGELGVLGSLETGMGEKEDGHGAEGVLSREQLLTDPDEAAR
FVAATKVDALAVAIGTSHGAYKFTQKPTGEVLAIDVIEKIHKRIPDTHLVMHGSSSVPEE
LLEIINKYGGAIPETYGVPVEEIQRGIRFGVRKVNIDTDLRLAVTAAVRKVLASNAKEFD
PRKFLKPAIEEQKKLCKARYEQFGTAGNASKIKIVPAAEMAKRYAKGDLDPKIS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtatcacgctaaggcaacttctggatcacgccgccgagcacggttacggcgtg
cccgcgttcaacatcaataacatggagcagggtatcgccatcctcgaagcggcgaaggaa
accgacagccccgtgatcatccaggcgagtcgcggcgcgcgctcctacgcgggcgacctt
ctgctcggcaagctcgtcgagggcctcgaagtccagtatccgaccatcccgatctgtatg
catcaggaccacggcaacaacgaagagacctgcgccagcgccatccgtctcggctatgac
agcgtgatgatggacggctcgctgaaggccgacggctcgacgcccgccgactacgattac
aatgtccgcatcacctcggacgtgacgcgcatggcgcattatgtcggcgtgtcggtcgaa
ggcgaactcggcgttctgggtagcctcgaaaccggcatgggcgagaaggaagacggccac
ggcgcggaaggcgtgctgtcgcgcgagcagcttctcaccgatcccgacgaagccgcgcgg
ttcgtcgccgcgacgaaggtggacgcgctcgccgtcgccatcggaacctcacacggcgcc
tacaagttcacgcagaagcccacgggcgaagtgctcgccatcgacgtcatcgagaagatc
cacaagcgcatcccggacacgcatctcgtgatgcatggctcgtcgtcggtgccggaagag
ctgcttgagatcatcaacaagtacggcggcgcgatccccgagacctacggcgttccggtc
gaggaaatccagcgcggcatccgcttcggcgtgcgcaaggtgaacatcgacaccgacctt
cgcctcgcggtgacggctgcggtgcgtaaggtgctcgccagcaatgcgaaggaattcgac
ccgcgcaagttcctgaagccggccatcgaggaacagaagaagctttgcaaggcgcgctat
gagcagttcggcacggccggcaatgcgtcgaagatcaagattgtcccggcggcggagatg
gccaagcgctacgccaagggcgacctcgatccgaagatcagctaa

DBGET integrated database retrieval system