KEGG   Rhodomicrobium vannielii: Rvan_2498Help
Entry
Rvan_2498         CDS       T01353                                 

Definition
(GenBank) magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase
  KO
K04034  anaerobic magnesium-protoporphyrin IX monomethyl ester cyclase [EC:1.21.98.3]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00860  Porphyrin and chlorophyll metabolism
rva01100  Metabolic pathways
rva01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rva00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rvan_2498
Enzymes [BR:rva01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.98  With other, known, physiological acceptors
    1.21.98.3  anaerobic magnesium-protoporphyrin IX monomethyl ester cyclase
     Rvan_2498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: B12-binding Radical_SAM Fer4_12
Motif
Other DBs
NCBI-ProteinID: ADP71713
UniProt: E3I648
Position
complement(2722962..2724788)
Genome map
AA seq 608 aa AA seqDB search
MRIVLIHPNYHSGGAEIAGRWSPAWVAYLAGYLKAGGYSDIRFIDAMTDNLTEDELRAIL
AEEKPDIIGSTAITPSIYKAERVLQIAKEVHPNVVTVLGGIHGTFMYSQILHEAPWIDAI
IRGEGEAVMLNLVKAIDKGEWPDSRGQVHGIAYQEGSKVIATPAEPPIRDVDSIVADWSI
LDWTKYHYIPMNTRVATPNMARGCPFTCSFCSQWKFWRDYRVRKPKLVVDEIETLVRDHN
VGFFILADEEPTINRKAFVAFCEELIERKLPVLWGINTRVTDILRDEDLLPMYRKAGLVH
ISLGTEAAAQLNLDLFNKETTVGQNKKAIDLLRANGIVTEAQFIVGLDNETLETLEETYK
MVREWNPDMANWSMFTPWPFSDLYRELGDSVEVFDFEKYNFVTPIMKPKAIDRGELLDGV
MKNYRRFYMNKALWGYPWVRGDKVRRKYLLGCLKAFLLSAYQRQFYDLGKRGYWGPQTKK
KLKFDFDTSRTLEKTPELQISSNAWKAAPKRKAEASPVAAAAAKVRGDDVNDPQKVMACG
GGDQQLDEATMAAAIGGSVAKPTMDAGCGCSGESKHEHTEAGECKGHGTEGSCGCETAEA
KADTPAKV
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgcggattgtacttatccatcctaattatcattcgggcggcgccgaaatcgcgggccga
tggtcccctgcatgggtggcctatctcgccggttatctgaaggcgggcggctattccgac
atccgcttcatcgacgcgatgacggacaacctcaccgaggacgagctccgcgcgatcctc
gccgaggaaaagcccgacatcatcggctcgacggccataaccccgtccatctacaaagcc
gagcgcgtgcttcagatcgccaaggaagttcacccgaacgtggtgactgtgctgggcggc
atccacggcacgttcatgtattcgcagatcctgcacgaagccccgtggatcgacgccatc
atccgcggcgaaggcgaagcagtcatgctgaacctcgttaaggcgatcgacaagggtgaa
tggcccgacagccgcggccaggtccacggcatcgcctatcaggaaggctcgaaggttatc
gctaccccggccgagccgccgatccgcgacgtcgattctatcgtcgccgactggtccatc
ctcgactggacgaaatatcactacatcccgatgaacacgcgcgtcgccacgccgaacatg
gcgcgcggctgtccgttcacctgtagcttctgctcgcagtggaagttctggcgcgactat
cgcgtgagaaagccgaagctcgtcgtcgatgaaatcgagacgttggtgcgcgatcacaat
gtcggcttcttcattctcgccgacgaagaaccgaccatcaaccgcaaggcgttcgtggcg
ttctgcgaagagctgatcgagcgcaagttgccggttctctggggcatcaacacccgcgta
accgacatccttcgtgacgaagacctgctgccgatgtaccgcaaggcgggcctcgtgcac
atctcgctcggcacggaagcggcggcgcagctcaacctcgacctgttcaacaaggaaacg
acggttgggcagaacaagaaggccatcgaccttctccgcgcgaatggcatcgtgaccgag
gcgcagttcatcgtcggcctcgacaacgagacgctcgaaacgctcgaagaaacatacaag
atggttcgcgagtggaacccggacatggccaactggtcgatgttcacgccgtggccgttc
tcggacctttaccgcgagctcggcgactcggtcgaagtgttcgacttcgagaagtacaac
ttcgtgacgccgatcatgaagccgaaggccatcgaccgtggcgaactgctcgacggcgtt
atgaagaactaccgccgcttctacatgaacaaggcgctgtggggctatccgtgggtgcgt
ggcgacaaggtgcgccgcaagtatctgctcggctgcctgaaggcgttcctgctctcggca
taccagcgccagttctacgatctcggcaagcgcgggtactggggtccgcagacgaagaag
aagctcaagttcgacttcgacacgtcgcgtacgctggaaaagacgcccgagcttcagatc
tcgtcgaacgcgtggaaggccgcgccgaagcgcaaggctgaagcctccccggtggctgcg
gctgccgcgaaagtacgcggcgacgacgtgaacgatccgcagaaggtcatggcttgcggc
ggtggcgaccaacagctcgacgaagcgacgatggctgctgccatcggcggcagcgttgcg
aagccgacgatggacgcaggctgcggttgctcgggagagtcgaagcacgagcacaccgaa
gctggcgagtgcaagggtcacggcacggaaggcagctgcggttgcgagacggccgaagcg
aaggccgacacgcccgccaaggtttag

DBGET integrated database retrieval system