KEGG   Rhodomicrobium vannielii: Rvan_3253
Entry
Rvan_3253         CDS       T01353                                 

Name
(GenBank) Carbohydrate-selective porin OprB
  KO
K07267  porin
Organism
rva  Rhodomicrobium vannielii
Brite
KEGG Orthology (KO) [BR:rva00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rva02000]
    Rvan_3253
Transporters [BR:rva02000]
 Other transporters
  Pores ion channels [TC:1]
   Rvan_3253
SSDB
Motif
Pfam: OprB
Other DBs
NCBI-ProteinID: ADP72448
UniProt: E3I261
Position
3547445..3548881
AA seq 478 aa
MRRHQPGSSALCGGRHFKAITICTACLAGALLIPALNATPALADEKDGLPEQSIATSLDG
GPDKDARAALAAKGVTYGINYIGEVWTNSGGREDVTTYLGRLEILVDADLEKLWGPKGLT
FHVNGYQIHGAGLEKYLGYPLDFISSIEALPSSRLFELWLEQKFGERVSVRAGQLAVDSE
FMTSETAGKFLNSSFGWPAIWSTDLPNGGNAYPLATPGARVKVEMTDKLTFLGAIYNGNP
AGCLDGQRCNRNGIDFRTQDPPFVIEEVQYKYNQRAKGVEKDGGNKGKENASTDLLSLPG
IIKFGAWQHFDNFRDVYSGTLIDADINVSPRGFWGNYGFYALVDQQIYRLANDPENGVFV
FTRIAAAPSERNIVSFYIDGGVFFRGFVPGRSEDTFGAAQTYVQVSGDASDADRYIADYT
DPSYRVRNFEAVAEVFYKFQIAPGFAVQPDLQYMWNPGGGIAENKDAVYGGVRVSIAY
NT seq 1437 nt   +upstreamnt  +downstreamnt
gtgagacgacatcaaccaggttcaagcgccctttgcggaggcaggcatttcaaagccatc
acgatctgcaccgcatgccttgcaggcgccctgctgatcccggctctaaacgcgaccccc
gcacttgctgacgaaaaagacggcctgcccgagcaatccatcgccacgagcctcgatggc
ggacccgacaaggatgcgcgcgccgcgttggcagcgaaaggcgtcacatacggcattaac
tacatcggtgaagtctggaccaattccggcggccgggaagacgtcaccacctacctcggc
cgacttgaaatcctcgtcgatgccgatctcgaaaagctgtgggggcccaaggggctgaca
ttccacgtgaacggctatcagatccacggagcgggactcgaaaaatatctcggctacccg
ctcgatttcatcagctccattgaggcgctgccttcctcacggcttttcgaactctggctc
gaacagaagttcggagagcgcgtgtcggtgcgcgccggtcaactcgcggtcgacagcgag
tttatgacctccgaaaccgccggcaagttcttgaactcctcattcggctggcccgctatc
tggtcgaccgacctgccgaatggcggaaacgcgtatcctctggcgacgcccggcgcgcgt
gtgaaagtcgagatgacggacaagctgacctttctcggggcgatctacaatggcaatccg
gctggctgtctagacgggcagcgctgcaaccgcaatggcatcgacttccgcacgcaagac
ccgcccttcgtcattgaggaagtacagtacaaatataatcagcgcgcgaaaggcgtggaa
aaggacggcggcaataagggtaaggaaaatgcctcaaccgatcttctgagcctccccggt
atcataaagttcggggcgtggcagcacttcgacaatttccgggatgtatattcgggaacg
ctcatcgatgccgatatcaatgtgtcgccgagggggttttggggaaattacggcttttac
gcgctggtcgatcagcagatttatcggctggccaacgatccagagaacggtgtcttcgtt
tttacgcgcatcgcggctgcgccctcggaacgcaacatcgtgagtttctacatcgacggc
ggcgtcttcttccgaggttttgttccaggccgttcggaagacacctttggcgcggcgcag
acatatgtccaggtctcgggcgatgcaagcgatgcggatcgttacatcgcggattataca
gacccctcctatcgtgtgcgcaatttcgaagccgtggcggaagtcttctacaagtttcag
atcgcgccaggcttcgcagtccagccggatctgcaatatatgtggaatccgggcggcggc
atcgcggagaacaaggacgcggtctacggcggcgttcgtgtcagcatcgcctattga

DBGET integrated database retrieval system