KEGG   Rhodomicrobium vannielii: Rvan_3330Help
Entry
Rvan_3330         CDS       T01353                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00010  Glycolysis / Gluconeogenesis
rva00052  Galactose metabolism
rva00500  Starch and sucrose metabolism
rva00520  Amino sugar and nucleotide sugar metabolism
rva00521  Streptomycin biosynthesis
rva01100  Metabolic pathways
rva01110  Biosynthesis of secondary metabolites
rva01120  Microbial metabolism in diverse environments
rva01130  Biosynthesis of antibiotics
rva01200  Carbon metabolism
Module
rva_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rvan_3330
   00052 Galactose metabolism
    Rvan_3330
   00500 Starch and sucrose metabolism
    Rvan_3330
   00520 Amino sugar and nucleotide sugar metabolism
    Rvan_3330
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rvan_3330
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Rvan_3330
Enzymes [BR:rva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rvan_3330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ADP72515
UniProt: E3I2S0
Position
complement(3627128..3628048)
Genome map
AA seq 306 aa AA seqDB search
MTPWRLIADVGGTNVRFARVFDGLVVAERRAYQGARFESFIHAMRAYAAETGGLAGCASV
AIGAAGPVAAGEIHLTNIAWTIREAEVEAEAGAPCTLLNDVEAAAYGALTLTEPDYALLS
GPAPDLSRAMRLLIANIGTGFGAAALFKVANVWVSCPSEAGHMSLRLPDDAPAGLRSAFP
SVEHALSGRGLVDLHAALSGRDDGLSARDICANAAYDPAAAATIRLFAEITGSVLGDLTL
AYTAWDGVFLVGSVAKGCAATDPRAMRAAFENKGPMSDRLKAVPVALMLKEDPAFFGLAI
APMRTR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccgtggcgtctcatcgccgacgtgggcggcacgaatgtgcggttcgcgcgcgtg
ttcgatggccttgtcgttgctgagcgccgcgcttatcagggtgcgcgcttcgaaagcttc
attcatgcgatgcgcgcttatgcggccgagaccggcggtcttgcgggctgcgcttcggtc
gccatcggtgcggctgggcctgtcgcggcgggcgaaattcacctgaccaacatcgcctgg
acgatccgcgaggcggaggtcgaggcggaggcgggcgccccctgcacactgctcaacgat
gtcgaggcggcggcctatggtgcgctcacactgacggagccggattacgcgctgttgagt
ggcccggcaccggacctgagccgggcaatgcgcctcctcatcgcgaatatcggcaccggc
ttcggcgcggcggcgctgttcaaggtggcgaacgtgtgggtttcgtgtccgagcgaggcg
gggcatatgtcgctgcgcctgccagacgatgcccctgctggtttgcggtcggcttttccc
tccgtggagcatgcactttccgggcgcggccttgtcgaccttcacgcggcgctcagcgga
cgcgatgacgggctgtccgcgcgcgacatctgcgccaatgccgcgtacgatcccgcagcg
gcggctacaatccgtctcttcgccgaaatcaccggaagcgtactcggcgacctgacgctc
gcctatacggcgtgggacggtgtgttcctcgtcggcagcgtcgccaagggctgcgccgcc
accgatccgcgcgcgatgcgtgccgcgttcgagaacaaggggccaatgtcggaccggctg
aaggctgtgcccgtcgccctcatgctgaaggaagaccctgcgttcttcggcctcgcgatc
gcgccgatgcgcacgcgctaa

DBGET integrated database retrieval system