KEGG   Rhodomicrobium vannielii: Rvan_3408Help
Entry
Rvan_3408         CDS       T01353                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00071  Fatty acid degradation
rva00072  Synthesis and degradation of ketone bodies
rva00280  Valine, leucine and isoleucine degradation
rva00310  Lysine degradation
rva00362  Benzoate degradation
rva00380  Tryptophan metabolism
rva00620  Pyruvate metabolism
rva00630  Glyoxylate and dicarboxylate metabolism
rva00640  Propanoate metabolism
rva00650  Butanoate metabolism
rva00900  Terpenoid backbone biosynthesis
rva01100  Metabolic pathways
rva01110  Biosynthesis of secondary metabolites
rva01120  Microbial metabolism in diverse environments
rva01130  Biosynthesis of antibiotics
rva01200  Carbon metabolism
rva01212  Fatty acid metabolism
rva02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rvan_3408
   00630 Glyoxylate and dicarboxylate metabolism
    Rvan_3408
   00640 Propanoate metabolism
    Rvan_3408
   00650 Butanoate metabolism
    Rvan_3408
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rvan_3408
   00072 Synthesis and degradation of ketone bodies
    Rvan_3408
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rvan_3408
   00310 Lysine degradation
    Rvan_3408
   00380 Tryptophan metabolism
    Rvan_3408
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rvan_3408
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rvan_3408
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rvan_3408
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rva04147]
    Rvan_3408
Enzymes [BR:rva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rvan_3408
Exosome [BR:rva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rvan_3408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADP72590
UniProt: E3I3E2
Position
3713582..3714781
Genome map
AA seq 399 aa AA seqDB search
MSKNTDAIVIASVVRTPIGAFQGAFASLAAPELGAVALRASVERAGLTASDIDEVFMGCV
LGAGVGQAPARQASLRAKLPLSAGCTTINKVCGSGLKAVMLGHDAILAGSARVVSAGGME
SMTNAPYLLPKARGGQRLGHDRVLDAMFFDGLEDAYGPETKGRLMGTFAEECAAAYGFTR
DEQDAYAVASATRARAAVEGGAFDWETVPVTVETRKGAAIVERDEQPGRIDIAKIPTLKP
AFREGGTVTAANSSSISDGAAAVTLMRRSTAEAKGVAPLATILGHTTYSDEPRLFPTAPI
HAIRALLDKLGWRAGDVDLYEINEAFAVVAMAAMRDLGLPHDKVNIGGGACALGHPIGAS
GARVLVSLIGALRRTGAKRGIASLCIGGGEAVALAIEID
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaacaccgacgccatcgtcatcgcgtccgtcgtgcggacaccaatcggcgcg
tttcagggcgcgttcgcgagcctcgccgcccccgaactcggcgcggtggcgcttcgggca
agcgttgagcgcgcagggctcacggcatccgacatcgatgaagtctttatgggctgcgta
ctcggcgctggcgtgggccaggcacccgcgcggcaagcctcgctccgcgccaagctgccg
ctttcggcgggatgcaccacgatcaacaaggtgtgcggttcaggcctcaaggcggtgatg
ctcggccacgatgcgatccttgccggcagcgcgcgtgtggtctcggcgggcggcatggag
tcgatgacgaatgcgccgtatcttctgccgaaggcgcgcggcggacagcgcctcggccat
gaccgcgtgctcgacgcgatgttcttcgacgggctggaagatgcttatggccctgaaacg
aaggggcggctgatgggcactttcgcggaggagtgcgcggccgcctacggcttcacccgc
gacgagcaggacgcttacgccgtggcctccgcgacgcgggcgcgggcggcggtggagggc
ggcgcgttcgattgggagacggtgccggtcaccgtcgaaacccgcaagggcgcggcgatc
gtggagcgcgacgaacagccgggtcgcatcgacatcgcgaaaatccccacgctgaagcct
gcgttccgggaaggtggcacggtgacagccgccaattcgagttcgatctctgacggcgcg
gccgctgtcacgctgatgcgccgctcgacggcggaggcgaaaggcgtcgcaccgctggcg
acgatcctcggccatacgacctattccgacgagccgcgcctgttcccgaccgcgccaatc
catgcgatccgggcgctcctcgacaaactcggctggcgcgccggggatgtcgacctgtac
gagatcaacgaggccttcgccgtggtcgccatggcggcgatgcgcgacctcgggcttccc
catgacaaggtcaacatcggcggcggggcatgcgcgctaggccatcccatcggcgcatcg
ggcgcgcgcgtgctcgtgtcgctgatcggcgcgctgaggcggacgggcgcgaagcgcggc
atcgcgagcctgtgcatcggcggcggcgaagccgttgcgctcgctatcgaaatcgactga

DBGET integrated database retrieval system