KEGG   Candidatus Rickettsiella viridis: RVIR1_00960Help
Entry
RVIR1_00960       CDS       T05765                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rvi  Candidatus Rickettsiella viridis
Pathway
rvi00450  Selenocompound metabolism
rvi00970  Aminoacyl-tRNA biosynthesis
rvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RVIR1_00960 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RVIR1_00960 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rvi01007]
    RVIR1_00960 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rvi03016]
    RVIR1_00960 (metG)
Enzymes [BR:rvi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RVIR1_00960 (metG)
Amino acid related enzymes [BR:rvi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RVIR1_00960 (metG)
Transfer RNA biogenesis [BR:rvi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RVIR1_00960 (metG)
 Prokaryotic type
   Other AARSs
    RVIR1_00960 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: BBB14637
UniProt: A0A2Z5V6T9
Position
complement(89239..90954)
Genome map
AA seq 571 aa AA seqDB search
MIHEDGELSGNTAEDSSAKSILVTTALPYANGSIHLGHLLEHIQADIWVRFQKMLGRNCI
FLSGEDAHGTPVMLAAKQRGIEPEELVKLIASEHKADLDAFHISFDNYYTTHSPENKALV
ELIYARMQAKGDIRTQVINQAYDPEAKMFLPDRYVKGNCPCCKTPDQYGDNCEACGSTYT
PLDLIDPKSTLSGATPIAKESEHYFFQLSNYADFLRTWITSEHHLAEEVSNKLLEWFKEG
LHDLDISRDTPYFGFKIPGTEDKYFYVWIDAPIGYMACFKNLCKRRPDLNFDEYWTNNEK
VALYHFVGKDIINFHAIFWPAILKSADFRTPSGVFVHGYLTVNGQKMSKSRGTFITAQDY
RQHLDPEYLRYYFAAKLNKKAEDIDLNLEDFTQRINADLVGKLVNIASRCASFISKRFDY
KLSPSCHAPKLVAHFIEKGDEIAQAYENREFSRAIRTIMDLADQANQIIDAEKPWALVKI
PEQIERAHAVCSLGLNLFRILMTYLKPVLPVTAEKVETFLNIVPMTWENRQELLCDHTIR
SFTPLLQRIQEEAIRAIQNDALTATQNLKIE
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgatacatgaggatggcgaattgagcggcaacactgccgaagattctagtgcgaagagt
atactagttaccacggcattaccctatgccaatggctccattcatttgggccatttatta
gagcatattcaagctgatatctgggtacgttttcaaaaaatgttagggcgtaattgtatc
ttcttatccggcgaagatgcccacggcacacccgtgatgttggccgctaaacaacgcggt
atagaaccagaagagttagttaagctcattgctagcgagcataaggccgatcttgatgcc
tttcatattagctttgataattattacaccacccattcacccgaaaacaaagcgctagta
gaattgatttatgcgcgtatgcaagccaaaggtgatattcgtactcaagtcattaatcag
gcctatgatcctgaagcaaaaatgtttcttcctgaccgctatgtaaaaggaaactgccct
tgttgtaaaacgcccgaccaatatggcgacaattgcgaagcttgtggttcaacctataca
cccttagatcttatcgatccgaaatctacactctccggcgccacaccaattgctaaagaa
tctgaacattatttctttcagctttcgaattatgccgattttctgcgtacatggattacc
agcgaacaccaccttgccgaagaggtcagcaataaacttttagaatggtttaaagaaggt
ttacatgatctcgatatttcgcgtgacacaccttattttggttttaaaattcctggcaca
gaagataaatatttttatgtttggatagatgcacccatcggatacatggcttgttttaaa
aatctctgtaaacgccgtcctgatcttaactttgatgagtattggacaaacaacgagaaa
gtagcgctctatcatttcgtaggaaaggatatcattaatttccatgctattttttggcct
gctatccttaaaagcgccgattttcgtacgccatcgggtgtttttgtacatggctactta
accgtcaatggccagaaaatgtcgaaatcccgtggcacttttatcaccgcgcaggattat
cggcagcacttagatcctgaatacctacgttattattttgccgctaaacttaacaaaaaa
gcggaagatattgatctaaatctcgaggatttcacccagcgaatcaacgctgatttagtt
ggaaaattagttaatattgctagtcgttgtgcgagttttatcagtaaacgctttgactat
aaactatcgccgtcttgtcatgcgccaaaattagttgcgcattttattgaaaaaggtgat
gaaattgcacaggcttatgaaaatcgtgaatttagccgtgcaatacgtaccattatggat
ttagcggatcaagccaatcaaattattgatgctgaaaaaccatgggctctagtaaaaatt
cctgagcaaatagaacgggcgcatgcggtttgtagtctaggattaaatctatttcgaatc
ttaatgacctatttaaaacctgtactgccggttactgcagagaaagtagaaacctttctt
aatatagtgccaatgacttgggaaaatcgtcaagagttactctgcgatcatactattcga
tctttcacgccgttattgcaacgtattcaagaagaagccatccgtgccatacaaaatgat
gctctaactgcgactcaaaatctaaaaatcgaatga

DBGET integrated database retrieval system