KEGG   Rubrobacter xylanophilus: Rxyl_0796Help
Entry
Rxyl_0796         CDS       T00368                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00260  Glycine, serine and threonine metabolism
rxy01100  Metabolic pathways
rxy01110  Biosynthesis of secondary metabolites
rxy01120  Microbial metabolism in diverse environments
rxy01130  Biosynthesis of antibiotics
rxy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rxy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rxyl_0796
Enzymes [BR:rxy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Rxyl_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABG03764
UniProt: Q1AXW4
Position
832297..833319
Genome map
AA seq 340 aa AA seqDB search
MIDLRSDTVTRPSEEMRRAMYEAPVGDDVFGEDPTVNRLEEYVAELLGKEAALYAPSGTM
TNQIGIHVSTSRGDEILVHEGAHVYNYEAGAPALLSGVQVRPLPGRDGVISPETVRDAIR
PEDDHFPRQRLLCLENTHNAAGGKVYPLEEFAAAAAEARRHGLRVHLDGARLFNAQVATG
IPAREWAAHADTVSVCSSKGLGAPVGSLLAGDAETIRRARRARKAFGGGMRQAGVIAAAA
LYAFRNNVERLAEDHERARRLAEGLAAAGYEVEPPETNMVLVRVEDVPGFLRKLAERGVL
ATPGRPGYVRFCTHLDVGDEEIERAVERAAGLVSAAAGRR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcttcgcagcgacacggtgacccggccctcggaggagatgcgccgggcgatg
tacgaggcgccggtcggcgacgacgtgttcggggaggaccccaccgtgaaccggctggag
gagtacgtggcggagctgctcggcaaggaggccgccctctacgcgccctccggcacgatg
accaaccagatcgggatccacgtaagcacctcgcggggagacgagatcctggtccacgag
ggggcgcacgtctacaactacgaggccggggcgcccgccctgctctcgggggtccaggtc
cggccgctccccggcagggacggcgtgatctctccggagaccgtgcgggacgcgatccgg
cccgaggacgaccacttcccccgccagcggctgctctgcctggagaacacccacaacgcg
gcgggcgggaaggtctacccgctggaggagttcgccgccgccgctgccgaggcccggcgc
cacggcctcagggtgcacctcgacggcgcccgtctcttcaacgcgcaggtggccaccggc
atccccgcccgcgagtgggccgcgcacgccgacacggtctccgtctgctcctccaagggc
ctcggggcgccggtcggctccctgctcgccggggacgcggagaccatccgccgggcccgg
cgggcgcgcaaggcgttcggcggcgggatgcgccaggccggcgtgatagcggccgcggcc
ctctacgccttccggaacaacgtcgagcggctggcggaggaccacgagcgcgcccggcgc
ctggcggagggactcgccgccgccggctacgaggtggagcccccggagaccaacatggtg
ctggtgcgggtggaggacgtgcccggctttctgcgcaagctcgcggagaggggcgtcctc
gccaccccggggcgcccggggtacgtccggttctgcacccacctcgacgtcggggacgag
gagatcgaacgggctgtggagcgcgccgccggcctcgtctccgcggccgccggccgccgt
tga

DBGET integrated database retrieval system