KEGG   Rubrobacter xylanophilus: Rxyl_0843Help
Entry
Rxyl_0843         CDS       T00368                                 

Definition
(GenBank) homocysteine S-methyltransferase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00270  Cysteine and methionine metabolism
rxy00670  One carbon pool by folate
rxy01100  Metabolic pathways
rxy01110  Biosynthesis of secondary metabolites
rxy01120  Microbial metabolism in diverse environments
rxy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rxy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rxyl_0843
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rxyl_0843
Enzymes [BR:rxy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Rxyl_0843
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     Rxyl_0843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR
Motif
Other DBs
NCBI-ProteinID: ABG03810
UniProt: Q1AXR8
Position
complement(880005..881840)
Genome map
AA seq 611 aa AA seqDB search
MGTSFRDLLDGRVLVGDGAMGTLLADRGVGYGHPYARANLTHPELVERLHGEYVRAGARA
IETNTFSANRIKLAGHRLEERVREINEAGARLARRAAAEAAERVLVLGAIGPLGRPLAPV
GRVPREEARALFREQAEALLEGGSDALLLETFTDLEELRLAWEAVRDLGAPVLAYKTFVE
DGETLAEGLPERAAREISGWGVELVGSNCTVGPQRMLGIVEQMSAAAGPVAAFPNPGLPQ
LVEGTVRYSHDVEHFARYGLRLAEAGARFVGGCCGTTPEHIRALSEALREFRPRRVTVAL
RGAAGPRKEGAREGGAGPRSRLAGKLHGGGFAVAVEVDLPRGNDLSGVVEAARRLKERGA
DAIDISDGARARLRMHPVAAARIVQERAGIEAVAHMSCRDRNILGLQADLLAAAALGVRN
ILAVTGDPAQIGDYPEATGVFDTDAVGLVHILSRMNRGEDLAGNAIGRPPGFLIGAAFNP
TAEDLDAEVERLRRKLEAGAHAFWTQPVFELPALERALERLEGTGARLLLGLMPLRSARQ
AEFLHHEVPGVKIPAEVRRKLAELSPQDAPRYGVEVAGNLLARARPLVSGAYIMPPASAP
ELAAEVMEALR
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgagcttcagggacttgctcgacgggcgggtgctcgtcggggacggggcgatg
ggcacgctgctggccgaccggggggtcggctacggccacccctacgcccgggccaacctc
acccacccggagctggtggagcggctgcacggggagtacgtgcgcgccggggcccgggcg
atagagaccaacaccttctccgccaaccggataaagctcgccgggcaccggctggaggag
agggtgcgcgagatcaacgaggcgggggcgcgcctggcgcgccgggccgccgcggaggcc
gcggagagggtgctggtgctcggggccatagggccgctgggccgcccgctcgcgccggtc
ggcagggtcccgcgcgaggaggcccgcgccctcttccgggagcaggccgaggcgctgctg
gagggcgggtccgacgcgctgctcctggagaccttcaccgacctggaggagctgcgcctg
gcctgggaggcggtgcgcgacctcggggcgcccgtgctcgcctacaagaccttcgtcgag
gacggcgagacgctcgccgaggggctgccggagcgggcggcgcgcgagatctcgggctgg
ggggtggagctggtgggctccaactgcaccgtcggcccgcagcgcatgctcggcatcgtg
gagcagatgtccgccgcggcggggccggtggccgccttccccaaccccggcctgccgcag
ctcgtggaggggaccgtccgctacagccacgacgtggagcacttcgcccgctacggcctc
aggctcgcggaggccggggcgcggtttgtcggggggtgctgcgggaccacgccggagcac
atccgggcgctctccgaggccctgcgggagttccgcccgcggcgggtcaccgtggcgctg
cggggggcggccgggccgcggaaggagggcgcgcgggagggcggcgccgggccgcgctcg
cggctcgcgggaaagctccacggcggcgggttcgccgtcgccgtggaggtggacctcccc
cgcggcaacgacctctccggggtcgtggaggcggcgcggcgcctcaaggagcgcggggcc
gacgccatagacatctccgacggggcccgggcgaggctccggatgcacccggtcgcggcg
gcccgcatagtgcaggagagggccggtatagaggcggtggcgcacatgtcctgccgcgac
cggaacatcctcggcctgcaggccgaccttctggccgccgcggcgctcggggtcaggaac
atcctggcggtgaccggggacccggcccagatcggggactaccccgaggccaccggcgtc
ttcgacaccgacgcggtggggctggtgcacatcctctcgcggatgaaccggggcgaggat
ctggcgggcaacgccataggccggccgccggggttcctgatcggggcggccttcaacccg
accgcggaggatctggacgcggaggtggagcggctgcggagaaagctggaggccggggcc
cacgcgttctggacccagccggtcttcgagcttcccgccctggagcgggcgctggagcgc
ctggagggcacgggggcgaggctcctgctgggcctgatgccgctgaggagcgcccgccag
gcggagtttctgcaccacgaggtgccgggggtaaagatcccggccgaggtccgcagaaaa
ctggcggagctctccccgcaggacgcgccccgctacggggtcgaggtggccgggaatctg
ctggcgcgggcccggccgctggtcagcggggcgtacatcatgcccccggccagcgccccg
gagctcgcagcggaggtgatggaggcgctgcggtag

DBGET integrated database retrieval system