KEGG   Rubrobacter xylanophilus: Rxyl_1102Help
Entry
Rxyl_1102         CDS       T00368                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00340  Histidine metabolism
rxy01100  Metabolic pathways
rxy01110  Biosynthesis of secondary metabolites
rxy01230  Biosynthesis of amino acids
Module
rxy_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Rxyl_1102
Enzymes [BR:rxy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Rxyl_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABG04068
UniProt: Q1AX10
Position
1136825..1138081
Genome map
AA seq 418 aa AA seqDB search
MAARLDARGLDAREVVRRLRRPRGFLSREVRAAVRQVVEEVRERGDEALLEYGERFDGVR
PDPLRVPREEIERARAALPGELAEAFRTAIENVRRFHERELDRSWELERGGARLGQRVRP
LRRAGIYVPGGHGAYPSTLVMTAVPAQVAGVEELCVCTPPGPDGRANPRLLAVAGLLGIG
EVYAAGGAQAVAAMAFGTESVPRVDKIVGPGNDYVTAAKLEVFGEVGVDAPQGPSELVVV
ADGSARPERVALDLMAQAEHLSGATSVLLTPSGALASGVEPLLSGRPSEHITLVLVRDLE
QALEISNLYAPEHVHLNCEGAGAALERVEAAGLVAVGDLSPVALSDYAAGPSHALPTGGT
ARWASALGTHDFLTRINHMRFSREALRELGPHVERLARMEGFENHAASVAARREKEEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
ttggcggctaggctggacgcccgcgggctggatgcccgggaggtggtccggaggctgcgg
cgcccgaggggcttcctctcccgggaggtgcgcgcggcggtccggcaggtggtggaggag
gtccgggagaggggggacgaggccctcctggagtacggcgagcgcttcgacggggtgcgc
ccggaccccctccgggtcccccgggaggagatagagagggcccgcgcggccctgccgggg
gagctcgcggaggccttccggaccgccatagagaacgtccgccgcttccacgagcgggag
ctggaccgctcctgggagctggagcgcggcggagcgcgcctcggccagcgggtgcggccg
ctgcggagggccgggatctacgtccccggcggccacggggcctacccgagcaccctggtc
atgaccgccgtcccggcgcaggtggcgggggtggaggagctgtgcgtctgcaccccgccc
ggccccgacgggcgggcgaacccccggctgctcgcggtggccgggcttctggggatcggg
gaggtctacgcggcgggcggggcccaggcggtggcggcgatggccttcggcaccgagagc
gtcccgcgggtggacaagatcgtgggccccggcaacgactacgtgaccgccgccaagctg
gaggtcttcggcgaggtgggcgtggacgccccccagggcccgagcgagctcgtggttgtc
gccgacggctccgcccgcccggagcgggtggcgcttgacctcatggcccaggccgagcac
ctctccggcgccacctcggtgctcctcaccccgagcggggcgctcgcgagcggcgtggag
cccctgctctccggcaggccctccgagcacataaccctcgtgctggtgcgcgacctggag
caggcgctggagatctccaacctctacgccccggagcacgtgcacctgaactgcgagggg
gccggggcggcgctggagcgggtggaggctgcggggctcgtggccgtcggggacctcagc
cccgtggccctctccgactacgccgccggcccctcccacgccctgcccaccggcgggacc
gcccgctgggcctccgccctcgggacccacgacttcctcacccgcataaaccacatgcgc
ttctcccgggaggcgctccgggagctcgggccgcacgtggagcggctcgcccgcatggag
ggcttcgagaaccacgccgcgagcgtcgcggcgcgcagagagaaggaggaggggtga

DBGET integrated database retrieval system