KEGG   Rubrobacter xylanophilus: Rxyl_1704Help
Entry
Rxyl_1704         CDS       T00368                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00010  Glycolysis / Gluconeogenesis
rxy00620  Pyruvate metabolism
rxy00640  Propanoate metabolism
rxy00680  Methane metabolism
rxy01100  Metabolic pathways
rxy01110  Biosynthesis of secondary metabolites
rxy01120  Microbial metabolism in diverse environments
rxy01130  Biosynthesis of antibiotics
rxy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rxyl_1704
   00620 Pyruvate metabolism
    Rxyl_1704
   00640 Propanoate metabolism
    Rxyl_1704
  Energy metabolism
   00680 Methane metabolism
    Rxyl_1704
Enzymes [BR:rxy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rxyl_1704
Lipid biosynthesis proteins [BR:rxy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rxyl_1704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABG04664
UniProt: Q1AVB4
Position
complement(1730232..1731962)
Genome map
AA seq 576 aa AA seqDB search
MVVGRVKCPRDRWPERGGGCTMAPDDFWASLTSRMPRRLDYETLYEGFSWDLPRPYNIGT
DVCDRHAWEPGRLALIHDRGDGTAEKWTFRELKLASDRFANALRGLGVERGDRVAVLLSQ
TPQLPVAHIAVYKLGAVTVPLFALFGEDALRFRLSDSGARVIVTDEEHFEVAASLREELE
ELEHVVLTGGGRAGALGFDDLVREASPFFRPVETGPDDPAIIIYTSGTTGSPKGALHGHR
ILLGHLPGVSLPHDLAPRRGDLFWTPADWAWIGGLFDVLFPALHWGLPVLSCRMRRFDPE
RAFDLMERWGVRNVFLPPTALKMMRAVGSPRSRWRLELETLACGGEPLGEESLAWAREEL
GLPINEFYGQTECNLVLSNCSAIMPIKPGSMGRPVPGHRVAIIDAEGRELPPGEVGEVAV
LRPDPVMMLGYWNNERATEAKFVGDWLRTGDLATRDGEGYFRFVGRDDDVITSSGYRIGP
AEIEETLVKHPRVLMAAAVGRPDPVRGEVVKAFVVLREGEGDEALAEELKELVRRRLGAH
EYPREVEFVPELPLTATGKIRRNVLRARERERVRRP
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgtggggcgggtaaaatgcccccgggacaggtggccggagagaggaggagggtgc
acgatggccccggacgacttctgggcttcgcttacctcccggatgccccggaggctggac
tacgagacgctctacgagggcttttcctgggatcttccgcgcccgtacaacatcgggacc
gacgtctgcgaccggcacgcttgggagccggggaggctcgccctcatccacgaccggggc
gacgggacggccgagaagtggaccttccgggagctcaagctcgcctcggaccgcttcgcc
aacgcgctgcgggggctcggggtggagcgcggcgaccgggtggccgtgctgctctcgcag
acgccgcagctgccggtggcgcacatcgccgtctacaagctcggcgccgtcaccgtcccc
cttttcgcgctcttcggggaggacgcgctgcgcttccggctctccgacagcggggcccgg
gtgatcgtaaccgacgaggagcacttcgaggtggccgcgtcgctgcgcgaggagcttgag
gagctggagcacgtcgtgctcacggggggcgggcgcgccggggctctgggcttcgacgac
ctggtccgggaggcctctcccttcttccggccggtcgagacgggcccggacgacccggcg
atcatcatctacacctcggggacgactgggtctcccaagggggcgctgcacgggcacagg
atcctgctcgggcacctgcccggggtgagcctgccgcacgacctcgcgccgcgccggggg
gacctgttctggaccccggcggactgggcctggatcggggggctcttcgacgtgctgttc
cccgcgctgcactgggggctgccggtgctctcctgcaggatgcggcggttcgacccggag
cgggcgttcgacctgatggagcgctggggcgtgcgcaacgtcttcctgccgcccacggcg
ctcaagatgatgcgggccgtgggctcgccgcgcagccgctggcgcctggagctcgagact
ctggcctgcggcggcgagcctctcggcgaggagtcgctggcgtgggccagggaagagctt
gggctccccataaacgagttctacggccagaccgagtgcaacctcgtgctctccaactgc
tcggccatcatgcccataaagcccggttccatgggccggccggtgccggggcacagggtg
gcgatcatcgacgcggaggggagggagctcccgcccggcgaggtgggggaggtggccgtc
ctgcggccggatcccgtcatgatgctcggttactggaacaacgagcgggccaccgaggcg
aagttcgtcggcgactggctcaggaccggggatctcgccacccgcgatggggaggggtac
ttccgcttcgtggggcgggacgacgatgtgatcacctcctccggctaccgcatagggccg
gccgagatcgaggagaccctcgtcaagcacccccgggtgctgatggccgcggcggtgggc
aggccggacccggtgcgcggggaggtggtgaaggcgttcgtggtcctcagggagggggag
ggcgacgaggcgctggccgaggagctgaaggagctggtccgcaggaggcttggggcgcac
gagtacccgcgggaggtggagttcgtccccgagctgccgctgacggcgaccggcaagatc
cggcgcaacgtcctgcgcgcccgcgagagggagagggtgagaagaccgtga

DBGET integrated database retrieval system