KEGG   Rubrobacter xylanophilus: Rxyl_2003Help
Entry
Rxyl_2003         CDS       T00368                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00010  Glycolysis / Gluconeogenesis
rxy00051  Fructose and mannose metabolism
rxy00562  Inositol phosphate metabolism
rxy01100  Metabolic pathways
rxy01110  Biosynthesis of secondary metabolites
rxy01120  Microbial metabolism in diverse environments
rxy01130  Biosynthesis of antibiotics
rxy01200  Carbon metabolism
rxy01230  Biosynthesis of amino acids
Module
rxy_M00002  Glycolysis, core module involving three-carbon compounds
rxy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rxyl_2003
   00051 Fructose and mannose metabolism
    Rxyl_2003
   00562 Inositol phosphate metabolism
    Rxyl_2003
Enzymes [BR:rxy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rxyl_2003
Exosome [BR:rxy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rxyl_2003
  Exosomal proteins of bladder cancer cells
   Rxyl_2003
  Exosomal proteins of melanoma cells
   Rxyl_2003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABG04950
UniProt: Q1AUH8
Position
complement(2024651..2025421)
Genome map
AA seq 256 aa AA seqDB search
MAGERRPLMAANWKMNKTVREAQDYMAALLPRVADLAGEVDVAVFAPFTCLSEVARMAEG
SGVLAGAQNFFYEDSGAYTGEVSAPMLLDVGARASIVGHSERRELFCETDESVARKARRA
VEAGLLPVVCVGETEEERDAGRMWEKVSGQVRAVVEGLGDASGGRVVFAYEPIWAIGTGK
TASPEDAQDAIGRIRGLLRELRGEGFAEEARLLYGGSIKPENISEIMAQKDVDGGLVGGA
SLEVGSFLQLVEAARG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggagaggaggccgctcatggcggccaactggaagatgaacaagaccgtgcgg
gaggcgcaggactacatggccgcgctcctgccgcgggtggccgacctcgccggggaggtg
gacgtggctgtcttcgccccgttcacctgcctctcagaggtcgcccggatggcggagggc
tcgggcgtcctcgccggggcgcagaacttcttctacgaggactcgggggcctacaccggc
gaggtctccgccccgatgctcctggacgtgggggcgcgggcctccatcgtcggccactcg
gagcggcgggagctgttctgcgagaccgacgagtcggtggcgagaaaggcccgccgcgcc
gtggaggccgggctcctgcccgtcgtctgcgtcggggagaccgaggaggagcgcgacgcg
ggccggatgtgggagaaggtctccggtcaggtgcgggcggtggtcgaggggctcggggac
gcctccggggggcgggtggtcttcgcctacgagcccatctgggccataggcaccggaaag
accgcctcccccgaggacgcccaggacgccatcggtcgcatccgggggctgctccgcgag
ctgaggggggaggggttcgccgaggaagcgcgcctcctctacggcggctccataaagccg
gagaacatctccgagatcatggcgcaaaaagacgtcgacggcggcctggtcggcggggcg
agcctggaggtgggctcctttctgcagctcgtcgaggcggcgcgggggtga

DBGET integrated database retrieval system