KEGG   Rubrobacter xylanophilus: Rxyl_2184Help
Entry
Rxyl_2184         CDS       T00368                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00790  Folate biosynthesis
rxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rxyl_2184
Enzymes [BR:rxy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Rxyl_2184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABG05128
UniProt: Q1AU00
Position
complement(2199991..2200845)
Genome map
AA seq 284 aa AA seqDB search
MAHTGTVRAGDRRLGPRPVLMGIVNVTPDSFSDAGEAFSAERAAERALRLLEEGADVIDV
GGESTRPGADPVPVGEEIRRVVPAIREILAERPEAVVSVDTYRSETAEAALEAGALMVND
ITALRGDPRMARLVAEAGCGVVLMHMRGTPKTMQRDPRYEDVVGEVREFLAGRAEAAVAA
GVDPGCILLDPGIGFGKTLEHNLALLGRLDAIAGVGFPVLVGTSRKGFLGKITGAQSPKE
RVFGTVATSVLAYGRGAFAFRVHDVRANREALRVAAAVEEVSSP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcataccgggacggtgcgggccggggaccggaggctgggtccccggcccgtcctc
atgggcatcgtgaacgtcacaccggactccttctccgacgccggggaggcgttctccgcg
gagcgggcggcggagcgggcgctgcggctgctggaggagggcgcggacgtcatagacgtt
ggcggggagtccacccgcccgggggctgacccggtcccggtcggcgaggagatccggcgg
gtggtgccggctatccgcgagatcctggccgagcgcccggaggcggtcgtctccgtggac
acctaccgctcggagacggccgaggccgccctcgaggccggcgcgctgatggtcaacgac
ataaccgcgctgcgcggcgacccccgcatggcgcggctcgtggcggaggccgggtgcggg
gtggtcctgatgcacatgcgggggacccccaagaccatgcagcgcgacccccgctacgag
gacgtggtcggggaggtgcgggagttcctcgccgggcgggccgaggcggccgtggccgcc
ggggtggaccccgggtgcatcctgctcgaccccggcataggcttcgggaagaccctggag
cacaacctcgctctcctcggccgcctggacgccatagcgggggtggggttcccggtcctc
gtgggcacctcccgcaaggggtttctcgggaagatcacgggcgcgcagagcccgaaggag
cgcgtcttcggcacggtggccacgagcgtcctcgcctacgggcggggggccttcgccttc
cgggtgcacgacgtgcgggccaaccgggaggccctgcgggtcgcggccgcggtggaggag
gtctcctcgccctga

DBGET integrated database retrieval system