KEGG   Rubrobacter xylanophilus: Rxyl_2843Help
Entry
Rxyl_2843         CDS       T00368                                 

Definition
(GenBank) Urate oxidase
  KO
K00365  urate oxidase [EC:1.7.3.3]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00230  Purine metabolism
rxy01100  Metabolic pathways
rxy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rxy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rxyl_2843
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Rxyl_2843
Enzymes [BR:rxy01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Rxyl_2843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Uricase
Motif
Other DBs
NCBI-ProteinID: ABG05755
UniProt: Q1AS73
Position
2850063..2850947
Genome map
AA seq 294 aa AA seqDB search
MTDTASKTSGRRIVLGHTNYGKSDIRLVKVFRNPGRHEIKELRVDVSQEGDFAAAHVEGD
NTGLMATDTMRNTVYALARDRLTGSAEAFGVELVRHFLEAAPRANRVRVSMVEHLWERIE
AGGKPHEHSFVRAAGERTAEVVGDEEGNFSVEAGIDDLLVLKTTNSGWAGFLRDRFTTLP
ETDDRILSTVVTSRWSYGGATDLDFDRLWEGIRRRILETFTDHYSPSVQFTLHRMGRAVL
ESFPEVERIHFSLPNRHHLLYDLERFGMENPGEVFHADAEPYGLIEGTVERSAS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccgccagcaagacctccggcaggaggatcgtgctcggccacaccaactac
ggcaagtcagacatccggctggtcaaggtgttccgcaacccggggcggcacgagatcaag
gagctgcgcgtggacgtctcccaggagggagacttcgccgccgcccacgtggagggggac
aacaccggcctcatggccaccgacacgatgcgcaacacggtctacgcgctggccagggac
cgcctgaccgggagcgccgaggccttcggggtggagctggtgcgccacttcctcgaggcc
gcgccccgggcgaaccgcgtccgcgtgagcatggtcgagcacctctgggagcgcatcgag
gccggcgggaagccgcacgagcactccttcgtccgggccgccggggagcgcacggccgag
gtggtcggcgacgaggagggcaacttcagcgtcgaggccggcatagacgacctcctggtc
ctcaagaccaccaactccggctgggcgggctttctgcgcgaccggttcaccaccctgccg
gagacggacgacaggatcctctccaccgtcgtgacctcccgctggtcctacggcggcgcc
accgacctggacttcgaccggctgtgggaggggatccgccggcgcatcctggagaccttc
accgaccactacagcccctccgtccagttcaccctccaccgcatgggacgggcggtgctg
gagagcttcccggaggtggagcgcatccacttctcgctgcccaaccgccaccacctcctc
tacgacctggagcgcttcgggatggagaaccccggcgaggtcttccacgccgacgccgag
ccctacggcctgatcgaagggaccgtggagaggtccgcctcttga

DBGET integrated database retrieval system