KEGG   Rubrobacter xylanophilus: Rxyl_3184Help
Entry
Rxyl_3184         CDS       T00368                                 

Definition
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00260  Glycine, serine and threonine metabolism
rxy00630  Glyoxylate and dicarboxylate metabolism
rxy00670  One carbon pool by folate
rxy01100  Metabolic pathways
rxy01110  Biosynthesis of secondary metabolites
rxy01130  Biosynthesis of antibiotics
rxy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rxy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rxyl_3184
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rxyl_3184
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rxyl_3184
Enzymes [BR:rxy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Rxyl_3184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: ABG06089
UniProt: Q1AR89
Position
complement(3196032..3197150)
Genome map
AA seq 372 aa AA seqDB search
MVAVARGTLRRTPLYEEHRALGARLVDFAGWEMPVQYAGIKAEHEAVRTRAGLFDVSHMG
EVAFRGPDAERALQRLLTRDVSRLGEGQAGYAAVCLESGGTVDDVIAYRRGEGFLVVVNA
ANREKDLAHFRRHTADLDVEISDETEEWALLALQGPEAERLLQPFVAGDLSALGRYRFLE
THVDGGEAIVARTGYTGEDGFEVFLRPAEAPSLWRRLVEAGAAPAGLGARDTLRLEAGMC
LYGNELDEETTPLEAGISFAVHLHKEEEFVGQRALQRQRERGLRKKLVGFELEGRGIARH
GYPVAVGGERAGVVTSGTMSPTLGRAIGLAYVPPETEGGFEVLIRERPVPARIVPLPFYR
RKRNDPEGGASG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtggtagcggtggcgaggggaaccctgcgccgcaccccgctctacgaggagcacagggcc
ctgggcgcccggctcgtggacttcgcgggctgggagatgccggtgcagtacgcggggata
aaggccgagcacgaggcggtgcgcacccgcgccgggctcttcgacgtctcgcacatgggg
gaggtggccttccgcggcccggacgccgagagggcgctgcagcgcctcctcacccgcgac
gtctcccggctgggtgaggggcaggcgggctatgccgccgtctgcctggagagcgggggg
acggtggacgacgtgatcgcctaccgccgcggggagggcttcctcgtggtggtgaacgcc
gccaaccgcgagaaagacctcgcccacttccgcaggcacaccgcagacctcgacgtagag
atctccgacgagacggaggagtgggcgctgctcgcgctgcagggcccggaggccgagcgg
ctcctgcagccgttcgtcgcgggagacctctccgccctcgggcgctaccgcttcctcgag
acgcacgtggacgggggggaggcgatcgtggcccgcaccggctacaccggagaggacggc
ttcgaggtctttctccgccccgcagaggccccctccctgtggcggcgcctcgtcgaggcg
ggggctgctccggccgggctcggggcgcgcgacacgctgcgcctggaggcggggatgtgc
ctctacggcaacgagctggacgaggagaccacgccgcttgaggccgggatctccttcgcc
gtccacctacacaaggaggaggagttcgtcgggcagcgggccctgcagagacagcgggag
cgcgggctgcgcaaaaagctagtcggcttcgagctggaggggcggggcatagcccgccac
ggctacccggtcgccgtgggcggcgagcgggcgggcgtggtcaccagcgggacgatgtcc
ccgacgctgggccgcgccatcgggctcgcctacgtcccccccgagacggagggcggcttc
gaagtgctcatccgggagcggccggtcccggccaggatcgtcccgctccccttctaccgg
cgcaagagaaacgaccccgagggaggagccagtggctga

DBGET integrated database retrieval system