KEGG   Rubrobacter xylanophilus: Rxyl_3202Help
Entry
Rxyl_3202         CDS       T00368                                 

Definition
(GenBank) leucyl-tRNA synthetase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00970  Aminoacyl-tRNA biosynthesis
Module
rxy_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:rxy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rxyl_3202
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rxy01007]
    Rxyl_3202
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rxy03016]
    Rxyl_3202
   03029 Mitochondrial biogenesis [BR:rxy03029]
    Rxyl_3202
Enzymes [BR:rxy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     Rxyl_3202
Amino acid related enzymes [BR:rxy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Rxyl_3202
Transfer RNA biogenesis [BR:rxy03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Rxyl_3202
 Prokaryotic Type
    Rxyl_3202
Mitochondrial biogenesis [BR:rxy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Rxyl_3202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1_2 tRNA-synt_1 tRNA-synt_1g Anticodon_1 DZR DNA_ligase_ZBD tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ABG06107
UniProt: Q1AR71
Position
complement(3213896..3216349)
Genome map
AA seq 817 aa AA seqDB search
MSETFAKRASRRGYDPRAIEERWQRRWAETGLYKTDEDPSKPKHYALTMLPYPSGDLHVG
HWYAMTPSDTRARFMRMRGYRVFFPIGFDAFGLPAENAAIKRGIHPRDWTYSNIERMRGQ
LRQMGTMFDFDAEVVTCDPEYYRWNQWFFLKFYEKGLAYREKAPVDWCPSCNTTLAREQV
VGPDRRCERCDTPVIKRNLAQWLFKITDYAEELLDFSEIEWPERVKALQRNWIGRSEGAE
IEFEIEGYGGVTVFTTRPDTLFGATFFVVAPEHPAVESITTPERGEEVRAYVERAARMSE
IDRADVTREKTGVFTGAYAVNPANGERIPVYVADYVLMGYGTGAIMAVPAHDERDFEFAK
KHGIEIRTVIAPPDWDGSPLERAYVGEGQMVNSGPFDGTPSAEGREKVTGWLRERGVGRP
AVNYRLRDWLISRQRYWGTPIPIVYCERCGTVPVPEEDLPVLLPEDAEFMPTGESPLKFN
DEFRKTECPRCGGPAERETDTMDTFVDSSWYQYRYLSPHYEEGPFDPERGSRWLPVDQYT
GGIEHATMHLLYTRFFTKVMRDLGLVDFDEPMLRLFNQGVILGPDGNRMSKSRGNVVNPQ
EYVDRYGSDVLRCYLMFIGPWDEGGPWDPGGIEGVARWLRRAFTLVAGGDVSEAEADPGE
LSRRTHRLVKRVTEYLEGFRFNTAIAALMEHTNYLLAVKGEVGEEEWREAMRSFLLVLAP
FAPHHAEEMWEILGEEYSVHEQGWPSWDEELVREETVTLVVQVNGKLRDRVEAPAGVDEG
RARELALSSERVRAHVEGRELRKTVYVPGRLINLVVS
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgagacgtttgcgaagagagcttctcgcagggggtatgacccccgggcaatagag
gagcgctggcagcggcgctgggcggagaccggcctctacaagaccgacgaagacccgagc
aagcccaagcactacgcgctcaccatgctgccctacccgagcggggatctgcacgtgggg
cactggtacgccatgactccctcggacacccgggcgcgctttatgcggatgcgcggctac
cgggtgttcttccccataggattcgacgccttcgggctgcccgcggagaacgcggccata
aagcgcggcatccacccgcgcgactggacctactccaacatagagcggatgcgggggcag
ctgaggcagatgggcaccatgttcgacttcgacgccgaggtggtgacctgcgacccggag
tactaccggtggaaccagtggttcttcctgaagttctacgagaaagggctggcctaccgg
gagaaggccccggtcgactggtgcccgtcgtgcaacaccacgctcgcccgggagcaggtg
gtgggcccggacaggcgctgcgagcgctgcgacaccccggtcataaagaggaacctggcg
cagtggctcttcaagatcaccgactacgccgaggagcttctggacttctccgagatagag
tggcccgagcgcgtaaaggcgctgcagaggaactggatcgggcgctccgagggcgccgag
atagagttcgagatcgagggctacggcggggtcacggtgttcaccactcgcccggacacg
ctcttcggggccacgttcttcgtcgtcgcgccggagcacccggcggtggagagcatcacc
accccggagcggggggaagaggtgcgggcgtacgtggagcgggccgcccggatgagcgag
atagaccgggccgacgtcacccgggagaagaccggggtcttcaccggggcctacgcggta
aaccccgccaacggggagaggatcccggtctacgttgcggactacgtgctcatgggctac
gggacgggcgcgatcatggcggtccccgcccacgacgagcgggacttcgagttcgcgaag
aagcacggcatcgagatccggacggtcatagccccgccggattgggacggctctcctctg
gagagggcctacgtaggcgagggccagatggtcaactccggcccctttgacggcaccccg
agcgccgagggcagagagaaggtgaccggctggctcagggagaggggggtcggccgtccc
gccgtcaactaccggctgcgggactggctcatctcgcgccagcgctactgggggacaccc
atccccatcgtctactgcgagcggtgcgggacggtgccggtgcccgaggaggacctcccc
gtgctcctgcccgaggacgccgagttcatgcccaccggggagtcgccgctcaagttcaac
gacgagttccgcaagacggagtgcccgcggtgcggggggcccgcagagcgggagaccgac
accatggacaccttcgtcgactcctcctggtaccagtaccgctacctctccccgcactac
gaggagggacccttcgaccccgagcggggaagccgctggctgccggtcgaccagtacacc
ggcgggatagagcacgcgacgatgcacctgctctacacgcgcttcttcaccaaggtcatg
cgcgacctcgggctcgtggacttcgacgagccgatgctccggctgttcaaccagggggtc
atcctcggccccgacggcaaccggatgagcaagagccggggcaacgtggtgaacccccag
gagtacgtggaccgctacggctccgacgtcctgcgctgctacctgatgttcatcggcccg
tgggacgagggcgggccgtgggaccccggcgggatagagggcgtcgcgcgctggctgcgc
cgggccttcaccctcgtcgccgggggggacgtctccgaggccgaggccgaccccggcgag
ctttcgcgccgcacccaccggctggtgaagcgggtgaccgagtacctggagggcttccgc
ttcaacacggccatagcggcgctcatggagcacaccaactacctgctggccgtgaagggc
gaggtgggggaggaggagtggcgggaggccatgaggagcttcctgctggtgctcgccccc
ttcgccccgcaccacgccgaggagatgtgggagatcctgggcgaggagtactccgtgcac
gagcagggctggccctcctgggacgaggagctggtccgcgaggagacggtgaccctggtc
gtccaggtgaacggcaagctgcgcgaccgggtggaggcgccggccggggtggacgagggc
cgggcgcgcgagctcgccctctccagcgagagggtgcgcgcccacgtggagggccgcgag
ctccgcaagaccgtgtacgtgccggggcgcctgatcaacctggtcgtgagctaa

DBGET integrated database retrieval system