KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0169
Entry
SAUSA300_0169     CDS       T00323                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09790  uncharacterized protein
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:saa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SAUSA300_0169
SSDB
Motif
Pfam: DUF454 Glyoxalase_2
Other DBs
NCBI-ProteinID: ABD22737
UniProt: A0A0H2XIE7
Position
complement(191128..191511)
AA seq 127 aa
MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVE
NFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPK
SNHKIEE
NT seq 384 nt   +upstreamnt  +downstreamnt
atgcgacttattttaatcgtcattggcttaatatttacagcgcttggtattgcaggtgcc
gtattacctttactgccaacgaccccttttttactcgtagcagttttttgttttgctcga
agttcagatcgcttttacaattggcttattaatcaaaaaatttataaagaatatgtagaa
aacttttatttacatcgaggctacacgctacaacagaaaattaaaattttaattagctta
tacattgtaataggtttttcaatttatatggtggatgttcttgcagtccgtgtaggatta
atcataatggttatcatacaaaccgctgtactctttacatttgtaaaaacattacccaaa
tcaaatcataaaatagaggagtga

DBGET integrated database retrieval system