KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0656
Entry
SAUSA300_0656     CDS       T00323                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09705  uncharacterized protein
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:saa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SAUSA300_0656
SSDB
Motif
Pfam: Cupin_5
Other DBs
NCBI-ProteinID: ABD21557
UniProt: A0A0H2XI13
Position
732521..732994
AA seq 157 aa
MKSAEQWIDELQLESHPEGGFYRETIREVLKDGRRAPFSSIYFLLTDDNISHFHRIDADE
VWYYHAGDSLTIHMINPDGEYTTATLGTDIQNGDVLQYVVPKGTIFASSIEISNTFSLVG
CMCQPAFEFKQFELFKQSELITQYPHLKSVIEKYALK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgaaatcagcagaacaatggattgatgaattgcaacttgaatcacatcctgaaggtggt
ttctatagagagacaattcgagaagtattgaaagatggacgcagagcgccgtttagtagt
atttattttttacttacagatgacaatatttcgcattttcatcgaattgatgctgatgaa
gtatggtactatcatgctggcgattctctaacaattcatatgataaatccggatggggaa
tatacgactgcaacattgggtactgatatccaaaatggagatgtattgcaatatgtagtg
cctaaaggaacaatttttgcttcttcaatcgaaatatcaaatacttttagtttagtaggt
tgtatgtgtcaaccggcatttgagtttaagcagtttgaattgtttaagcaatctgaatta
attacgcaatatccgcatcttaaatcagtaatcgaaaaatatgctttaaaataa

DBGET integrated database retrieval system