KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0834
Entry
SAUSA300_0834     CDS       T00323                                 

Name
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00630  Glyoxylate and dicarboxylate metabolism
saa01100  Metabolic pathways
saa01110  Biosynthesis of secondary metabolites
saa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAUSA300_0834
Enzymes [BR:saa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     SAUSA300_0834
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored AdoHcyase_NAD IlvN
Other DBs
NCBI-ProteinID: ABD22722
UniProt: A0A0H2XIS1
Position
912873..913832
AA seq 319 aa
MVKIVVSRKIPDKFYQQLSKLGDVVMWQKSLVPMPKDQFVTALRDADACFITLSEQIDAE
ILAQSPNLKVIANMAVGYDNIDVESATANNVVVTNTPNVLTETTAELGFTLMLAIARRIV
EAEKYVEADAWQSWGPYLLSGKDVFNSTIGIYGMGDIGKAFARRLQGFNTNILYHNRSRH
KDAEADFNATYVSFETLLAESDFIICTAPLTKETHHKFNAEAFEQMKNDAIFINIGRGQI
VDETALIDALDNKEILACGLDVLANEPIDHTHPLMGRDNVLITPHIGSASVTTRDNMIQL
CINNIEAVMTNQVPHTPVN
NT seq 960 nt   +upstreamnt  +downstreamnt
ttggtaaaaatagttgtttcgaggaaaattccagataaattttatcaacaattaagtaaa
cttggtgacgttgttatgtggcaaaaatcattagtgcctatgcctaaagatcaatttgtg
acagcacttcgtgacgcagatgcttgttttattacattaagtgaacagatcgatgcagaa
attttagcgcaatcaccaaatttaaaagtaattgcgaatatggctgtaggatatgacaac
atcgatgttgaaagtgcaacagcgaataacgtggttgtcacgaatacaccaaatgtactt
actgaaacaactgcagaattaggatttacattaatgcttgctatagcacgccgtattgta
gaagctgaaaaatatgtagaagcagatgcatggcaaagctggggtccttatttattgtca
ggtaaagatgtcttcaattcaactattggaatatatggtatgggagatattggtaaagct
tttgcaagaaggttgcaagggtttaatactaatattctttatcataatcgatcaagacat
aaagatgcagaggcggactttaatgcaacatatgtttcttttgaaacgttgttagcagaa
agtgattttatcatctgtacagcgccacttacaaaagaaacacatcataaatttaatgct
gaagcatttgaacaaatgaaaaatgatgcaatttttattaatatcggtagaggacaaatt
gtagatgaaacagcattaatcgatgcactagacaataaagaaattttagcatgtggttta
gatgtattagcaaatgaaccgattgatcatacacatccattaatgggacgtgataatgtt
ctgattacaccacacattggtagcgcatcagtaacaacacgggacaatatgattcaatta
tgtattaataatatagaagcggttatgacaaatcaggtaccacatactccagtaaattga

DBGET integrated database retrieval system