KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0945
Entry
SAUSA300_0945     CDS       T00323                                 
Name
(GenBank) isochorismate synthase family protein
  KO
K02552  menaquinone-specific isochorismate synthase [EC:5.4.4.2]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00130  Ubiquinone and other terpenoid-quinone biosynthesis
saa01100  Metabolic pathways
saa01110  Biosynthesis of secondary metabolites
saa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:saa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SAUSA300_0945
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    SAUSA300_0945
Enzymes [BR:saa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     SAUSA300_0945
SSDB
Motif
Pfam: Chorismate_bind vATP-synt_E
Other DBs
NCBI-ProteinID: ABD22173
UniProt: A0A0H2XJA7
Position
1033198..1034409
AA seq 403 aa
MRLNDNRTSYFGYKAIQLFKNNSKNKQSIFKDWEKLKHNITFIHPQSEKHHLRVVGGFQF
SSHKSDDEWREFGLNHFVLPEVLISTDNNGTFLTYTVKRESFTVEALNDLMDLFNNISDI
DVDEQIGGITRNEDIYKDDWRQLVVEAIESINNEEKIVLARRRLIKFDKDISIPYILKQA
YSKEKNSYIFLLESQDSIFFSQTPEQLIKVNNKILSTKAVAGTIKRSQDEDEDTKNVEAF
LKDNKNLIEHRFVVDSILHDIKPYITELHYDKTPKILKNDHLYHLYTEIKAPLKDDSYIS
LIDNLHPTPALGGYPKEFAMDFIEQKEFGTRGLYGAPVGYIDIYDDCEFIVAIRSMLIKK
AQATLFAGCGIVKDSDPDSELAETNLKFTPMMNALGVDMNGKS
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgcgtttgaatgataatcgaacgtcatattttggctacaaagcaattcaattattcaaa
aataattctaaaaataaacaatctatttttaaagactgggaaaaattaaaacataacatc
acatttatacatccgcaatctgagaaacatcatcttcgagttgttggagggttccaattt
tcaagtcataaatcagatgatgaatggcgagagtttggactaaatcattttgtattacct
gaagttttaatttcaactgataataatgggacatttttaacttatacagttaaaagggaa
agttttactgttgaggcattgaacgatttaatggatttgttcaacaatatatcggacata
gatgtggacgagcaaattgggggaattactagaaatgaagatatttataaagatgactgg
cgtcaacttgtagtagaagctatagaatctattaataatgaagaaaaaattgtactagca
cgtagacggttaataaagttcgataaagatatcagtattccatatattctaaagcaagca
tattctaaagaaaaaaacagttatatattcttgttagaatcacaagattctatattcttt
tcacaaacacctgaacaattaataaaggtcaataataaaatactatcgactaaagctgta
gcaggtacaattaaacgttcacaagatgaggacgaagatacaaaaaatgttgaagcattt
ttaaaagataataaaaacttaatcgaacatcgatttgttgttgacagtattttacatgat
attaaaccttatatcactgaattacattatgataagacgcctaaaattctaaaaaatgat
catttatatcacttgtacactgaaataaaggcgccactgaaggatgattcgtatattagt
ttaattgataatttacatccaacacctgctttaggtggctatccaaaagaatttgcaatg
gattttattgagcagaaagaatttggtacgcgaggattatatggtgcaccggttggctat
atagatatatacgatgattgtgaatttattgttgcaattcgttcgatgcttattaagaaa
gcacaagcaactttatttgctgggtgtggcattgttaaagattctgatccagatagtgaa
ttggcagaaacgaaccttaagttcacacctatgatgaatgcattaggagtcgatatgaat
gggaaatcataa

DBGET integrated database retrieval system