KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0953
Entry
SAUSA300_0953     CDS       T00323                                 

Definition
(GenBank) putative membrane protein
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Motif
Pfam: Acyl_transf_3
Other DBs
NCBI-ProteinID: ABD20498
UniProt: A0A0H2XDQ3
Position
complement(1042430..1043440)
AA seq 336 aa
MTSLKERDYFFDNARAILILLVVFGHMLQPYTSGDKYLSALYLVIYSFHMPTFLFISGYF
AKNIDKPYYLEKISKRLIVPYMIFFAFFSIYYFLTGKSDELQLDPFNPVFALWFLITLFF
FHVILVIVRRFNPYKVLSVSIIISIGAGFSDNIDSYLSISRTIVFFPIFYLGYIFTKKHT
AIFKNKKLIPVSIITFILFFIVYVIHPINADWLLGSSPYTSLENEGQSIFSPFKRLILYG
IILIAMTAFLNLMSTKKKLYTYIGSRTLYVYLLHGLIIGIVRGFEWYPFDNPISLMTYLY
LISISVIIVYVLSTNFVCKWTNPIINLQRPSQFKDS
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgacttcattaaaagagagagattatttttttgacaacgcaagagcaattttaatatta
ttagtcgtatttggacatatgttacaaccctacactagtggcgataaatatttatcagca
ttatacctagttatttatagtttccatatgccaacatttttgtttatatctggttatttc
gcgaaaaatattgataaaccatactatttagaaaaaatttcaaaacgtttgatagtacct
tatatgatattttttgcattcttttcaatttattatttcttaacaggtaaaagtgacgaa
ttacaacttgatccttttaacccagtatttgcgttatggtttttgatcacgctatttttc
tttcatgtcattttagtaatagttagaagatttaatccatataaagtgctatcagtttca
attattatatctattggagcaggtttttcagataacatcgatagctacttaagcatttca
aggacaatcgtatttttcccaatattttatctaggttacattttcaccaaaaaacatacg
gctatttttaaaaataaaaaactaataccagtatctatcattacctttattttgtttttt
atcgtttacgtgattcatcctatcaatgcagattggttattgggaagttcaccatatact
tcacttgaaaatgaaggacagagtatattcagtccttttaaacgacttatattatatgga
attatattaatcgcaatgactgcgtttctaaatttaatgtcaacaaagaaaaaattatat
acttatattggtagtcgtacgctatacgtatatttattacatggtttaattattggcatt
gttagaggatttgaatggtacccattcgataatcctatatcattaatgacttatctttat
ttaataagtatatctgtaatcatcgtatatgtattatctacaaactttgtttgtaaatgg
acaaatccaataattaatttacaaagaccatcacagtttaaagattcataa

DBGET integrated database retrieval system