KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0954
Entry
SAUSA300_0954     CDS       T00323                                 
Name
(GenBank) transcriptional regulator, MarR family
  KO
K06075  MarR family transcriptional regulator, transcriptional regulator for hemolysin
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:saa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:saa03000]
    SAUSA300_0954
Transcription factors [BR:saa03000]
 Prokaryotic type
  Helix-turn-helix
   MarR family
    SAUSA300_0954
SSDB
Motif
Pfam: MarR MarR_2 HTH_27 TrmB HTH_34 zf-CCCH_7
Other DBs
NCBI-ProteinID: ABD22816
UniProt: A0A0H2XIJ8
Position
1043593..1044012
AA seq 139 aa
MYKQLEKLITLTNNDLNLVNRRFGQRTDIKSEQLELLRILFNYDRLSQYDLTMKISREQS
IVSRWIKKLVLKGYITSQQSSEDLRCKELILTDQARTLISQINNARCELIEARCQCLSEV
ELDNLNQLLDKLNQRRISL
NT seq 420 nt   +upstreamnt  +downstreamnt
atgtataaacaacttgaaaaacttattacactgactaacaatgacttaaacttagtgaat
agaagatttggacaacgcacggatatcaaatctgaacagctagaacttctccgtatttta
tttaattacgatcgcttatcacagtatgatttgacgatgaagattagcagggaacaatct
atagtttcaaggtggattaagaaattagttttgaaagggtacatcacaagtcaacaatct
agcgaagatttaagatgtaaagaattaattttgactgatcaagcacgtacattaatttca
caaataaataatgcacgttgcgaattgattgaagcaagatgtcaatgtttatcggaagtc
gaattagacaatttaaatcaattacttgataagttaaatcaacgacgcatatcgttgtaa

DBGET integrated database retrieval system