KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_1059
Entry
SAUSA300_1059     CDS       T00323                                 

Name
(GenBank) putative exotoxin 1
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
SSDB
Motif
Pfam: SSL_OB Stap_Strp_tox_C
Other DBs
NCBI-ProteinID: ABD21604
UniProt: A0A0H2XFZ2
Position
complement(1158771..1159487)
AA seq 238 aa
MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHF
SFSNKWLYQYDNGNIYVELKRYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQL
WWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAHKIYQGNKPVLTLKEIDFRAR
EALIKNKILYNENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD
NT seq 717 nt   +upstreamnt  +downstreamnt
atgagtaagaacatcacgaaaaatataattttaacgacaacattattactattaggtact
gtattacctcaaaatcaaaaaccagtatttagtttttactctgaagctaaagcttatagc
attggtcaagatgaaactaacatcaatgaattaattaaatattacacacagcctcatttt
tcattttcaaataaatggctatatcaatatgataatggaaacatttatgttgaacttaag
agatattcatggtcagcacatatatctttatggggcgctgaaagttggggaaatattaat
cagttaaaagatcgttacgtagatgtgtttggactaaaagacaaagatactgatcagtta
tggtggtcttatagagagacatttacaggtggcgttacaccagccgcaaaaccttctgat
aaaacttataatctttttgtgcaatacaaagataaactacaaacgattattggtgcgcat
aaaatataccaaggcaataaaccagtattaacattgaaagaaatcgatttccgtgcacga
gaagcgttaataaaaaataaaatattatataacgaaaatcgtaataaaggtaagcttaag
atcaccggtggcggtaataactacactattgatttaagcaaaagattacattcagatcta
gcaaatgtttatgttaaaaatcctaataaaataactgttgacgtcctctttgattag

DBGET integrated database retrieval system