KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_1384
Entry
SAUSA300_1384     CDS       T00323                                 

Definition
(GenBank) phiSLT ORF100b-like protein, holin
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Motif
Pfam: Holin_SPP1 Turandot DUF3783
Other DBs
NCBI-ProteinID: ABD21333
UniProt: A0A0H2XHK8
Position
complement(1549942..1550244)
AA seq 100 aa
MDAKVITRYIVLILALVNQFLANKGISPIPVDEESVSSIILTVVALYTTYKDNPTSQEGK
WANQKLKKYKAESKYRKATGQAPIKEVMTPTNMNDTNDLG
NT seq 303 nt   +upstreamnt  +downstreamnt
atggatgcaaaagtaataacaagatacatcgtattgatcttagcattagtaaatcaattc
ttagcgaataaaggtataagtccgataccagtagatgaagaaagtgtttcatcgattatc
ttaacagttgttgctttatatactacatataaagataatccaacatctcaagaagggaaa
tgggcgaatcaaaaattaaagaaatataaagctgaaagtaaatatagaaaagcaacaggg
caagcgccaattaaagaagtaatgacacctacgaatatgaacgacacaaatgatttaggg
tag

DBGET integrated database retrieval system