KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_1400
Entry
SAUSA300_1400     CDS       T00323                                 

Definition
(GenBank) phiSLT ORF92-like protein, uncharacterized phage protein (possible DNA packaging)
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
SSDB
Motif
Pfam: Phage_connect_1
Other DBs
NCBI-ProteinID: ABD22898
UniProt: A0A0H2XIP7
Position
complement(1566552..1566830)
AA seq 92 aa
MSLEEIKLWLRIDYNFENDLIEGLIQSAKSELLLSGVPDYDKDDLEYPLFCTAIKYIIAR
DYESRGYSNDQSRSKVFNEKGLQKMILKLKKW
NT seq 279 nt   +upstreamnt  +downstreamnt
atgagtttagaagaaattaaattgtggttgagaattgactataatttcgaaaatgattta
attgaaggtctcattcaatcggctaagtctgaattactattaagtggggttccagattat
gacaaagatgacttggaatacccgcttttttgtacagcgattaaatatatcattgcaaga
gattatgaaagtcgtggatactcaaatgaccaatctagaagcaaggtgtttaatgaaaaa
ggattgcaaaaaatgattttgaaattaaaaaagtggtag

DBGET integrated database retrieval system