KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_1470
Entry
SAUSA300_1470     CDS       T00323                                 

Name
(GenBank) geranyltranstransferase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00900  Terpenoid backbone biosynthesis
saa01100  Metabolic pathways
saa01110  Biosynthesis of secondary metabolites
Module
saa_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:saa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAUSA300_1470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:saa01006]
    SAUSA300_1470
Enzymes [BR:saa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     SAUSA300_1470
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     SAUSA300_1470
    2.5.1.29  geranylgeranyl diphosphate synthase
     SAUSA300_1470
Prenyltransferases [BR:saa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SAUSA300_1470
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-ProteinID: ABD21052
UniProt: A0A0H2XF90
Structure
PDB: 
1RTR

Position
complement(1625506..1626387)
AA seq 293 aa
MTNLPMNKLIDEVNNELSVAINKSVMDTQLEESMLYSLNAGGKRIRPVLLLLTLDSLNTE
YELGMKSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYGEWTAILAGDALLTKAF
ELISSDDRLTDEVKIKVLQRLSIASGHVGMVGGQMLDMQSEGQPIDLETLEMIHKTKTGA
LLTFAVMSAADIANVDDTTKEHLESYSYHLGMMFQIKDDLLDCYGDEAKLGKKVGSDLEN
NKSTYVSLLGKDGAEDKLTYHRDAAVDELTQIDEQFNTKHLLEIVDLFYSRDH
NT seq 882 nt   +upstreamnt  +downstreamnt
atgacgaatctaccgatgaataaattaatagatgaagtcaataatgaattatcggttgcg
ataaataaatcagtaatggatactcagctagaagaaagtatgttgtattcattaaatgct
ggaggtaaacgcatccgaccagttctgttattactcactttagattcactaaataccgag
tatgagttaggtatgaagagcgcaattgcactagaaatgattcatacatattcacttatt
catgatgacctaccagcgatggataatgatgattatcgacgaggaaaattaacaaatcat
aaagtatatggtgagtggactgcgatattagcaggtgatgctttattaactaaagcattt
gaacttatttcaagtgatgatagattaactgatgaagtaaaaataaaagttctacaacgg
ctgtcaatagcaagtggtcatgttggaatggtcggcggtcaaatgttagatatgcaaagc
gaaggccaaccaattgatcttgaaactttggaaatgatacacaaaacaaaaacaggagca
ttattaacttttgcggttatgagtgcagcagatatcgctaatgtcgatgatacaactaaa
gaacatttagaaagttatagttatcatttaggtatgatgttccagattaaagatgattta
ttagactgctatggtgatgaagcaaagttaggtaaaaaagtgggcagcgatcttgaaaat
aataaaagtacgtacgtgagtttattagggaaagatggcgcagaagataaattgacttat
catagagacgcagcagtggatgaactaacgcaaattgatgaacaattcaatacaaaacac
ttattagaaatcgttgatttattttatagcagggatcactaa

DBGET integrated database retrieval system