KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_1582
Entry
SAUSA300_1582     CDS       T00323                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
SSDB
Motif
Pfam: CsbD TBCA Etd1 MT0933_antitox DUF6353
Other DBs
NCBI-ProteinID: ABD22647
UniProt: Q2FGA1
Position
complement(1732647..1732829)
AA seq 60 aa
MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKVIGKAKEVVENAKNKITDAIDKLKK
NT seq 183 nt   +upstreamnt  +downstreamnt
atggcagacgaaagtaagttcgatcaatttaaaggaaatgttaaagaaacagtaggtaac
gttactgataacaaagaattagaaaaagaaggtcagcaagataaagtgattggtaaagca
aaagaagttgttgaaaatgctaaaaacaaaataactgatgcaattgataaacttaaaaaa
taa

DBGET integrated database retrieval system