KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_1764
Entry
SAUSA300_1764     CDS       T00323                                 

Symbol
epiD
Name
(GenBank) lantibiotic epidermin biosynthesis protein EpiD
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
SSDB
Motif
Pfam: Flavoprotein HNH_2
Other DBs
NCBI-ProteinID: ABD22271
UniProt: A0A0H2XJE3
Structure
PDB: 
3QJG

Position
complement(1949225..1949743)
AA seq 172 aa
MGENVLICLCGSVNSINISHYIIELKSKFDEVNVIASTNGRKFINGEILKQFCDNYYDEF
EDPFLNHVDIANKHDKIIILPATSNTINKIANGICDNLLLTICHTAFEKLSIFPNMNLRM
WENPVTQNNIRLLKDYGVSIYPANISESYELASKTFKKNVVAPEPYKVLEFI
NT seq 519 nt   +upstreamnt  +downstreamnt
atgggagaaaatgtattgatttgtttgtgtggctcagttaatagtatcaatattagccac
tatattattgaattaaaatcaaaatttgatgaagtaaatgtaatcgcgtcaacaaacggt
agaaagtttattaatggtgaaatattaaagcaattttgcgataactattatgacgaattt
gaagacccttttttaaatcatgtagatatagcaaataaacatgacaagattattatttta
cctgcgacttctaatacgattaataaaattgcaaatggtatatgtgacaatttattatta
actatttgtcatacagcttttgaaaaactttctatatttccaaatatgaatttacgaatg
tgggaaaatccagttactcaaaataatattcgattattaaaagattatggtgtatcaata
tatccagcaaatatttcagaaagttatgaattagcgtcaaaaacatttaaaaagaatgtt
gtcgcacctgaaccatataaagttctggaattcatttga

DBGET integrated database retrieval system