KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_2222
Entry
SAUSA300_2222     CDS       T00323                                 

Gene name
moaE
Definition
(GenBank) molybdopterin converting factor, subunit 2
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00790  Folate biosynthesis
saa01100  Metabolic pathways
saa01240  Biosynthesis of cofactors
saa04122  Sulfur relay system
Module
saa_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:saa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAUSA300_2222 (moaE)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SAUSA300_2222 (moaE)
Enzymes [BR:saa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     SAUSA300_2222 (moaE)
SSDB
Motif
Pfam: MoaE AhpC-TSA
Other DBs
NCBI-ProteinID: ABD22367
UniProt: A0A0H2XJJ5
Structure
PDB: 
2Q5W 2QIE

Position
complement(2391145..2391591)
AA seq 148 aa
MKQFEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKL
AQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVP
IWKKEIWEDGSKWQGHQKGNYEEAKREE
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaacaatttgaaatcgtgacagaaccgatacaaacagaacaatatcgtgaattcact
ataaatgaatatcaaggtgcagtagttgtttttaccggtcatgttcgcgaatggactaaa
ggcgtcaaaacggaatatttagaatatgaagcgtatattccaatggctgaaaagaaattg
gcacaaattggagatgaaataaatgaaaaatggcctggaacgataacgagtattgttcat
agaatagggccattacaaatttcagatatcgctgtattaattgcggtttcttcaccgcat
cgtaaagatgcctatcgagcaaatgaatatgcaattgagcgtataaaagaaattgttccg
atttggaaaaaagaaatttgggaagatggttcaaaatggcaagggcatcaaaaagggaat
tatgaagaagcgaagagggaggaataa

DBGET integrated database retrieval system