KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_2297
Entry
SAUSA300_2297     CDS       T00323                                 
Name
(GenBank) conserved hypothetical protein
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
SSDB
Motif
Pfam: UCH_N
Other DBs
NCBI-ProteinID: ABD22632
UniProt: A0A0H2XIR9
Position
2468869..2469507
AA seq 212 aa
MTNPNQRLEPFDETFQQPNIHRGKRYGKKKRSLVSMIIQIIVVILTAIAGYSMWKQPIFN
IVFTKESVDFDGIKNFNETIGKMHQLNINLGNINDLQQGIDRLILVFNGFFILCIVSLVI
TILTIVFNRTVLKVVNILVLTIMLVITLYFSYIIKALAQEIADVFKKYYLNVPPDQVITE
ADAIHNGIILLGCSIGLLVISLFFRNRMPRLK
NT seq 639 nt   +upstreamnt  +downstreamnt
atgacaaatccaaatcaacgattagaaccatttgatgagacatttcaacaaccgaatatt
catcgtggtaagcgatatggtaagaaaaaacgttcattggtaagcatgattattcaaatc
attgttgttatattaaccgcaatcgctggatacagcatgtggaaacaacccatttttaat
attgtcttcaccaaagaatctgtagattttgatggcattaaaaattttaacgagacaatt
ggaaaaatgcatcaattaaatattaatttgggtaatatcaatgatttacaacaaggaatc
gatcgcttaattttagtctttaacggtttctttattttatgtatcgttagcctagtcata
acaatactgacaattgtatttaatcgcacagttctaaaagtagtaaatattttagtgtta
acaattatgttagtcattacattgtatttcagttatattattaaagcactcgcacaagaa
attgcagatgttttcaaaaaatattatttaaatgtaccaccagatcaagtgattacagaa
gctgacgctattcataacggcatcattttacttggctgtagcatcggtttacttgttata
agcttattcttccgtaatcgcatgcctcgtttaaaataa

DBGET integrated database retrieval system