KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_2299
Entry
SAUSA300_2299     CDS       T00323                                 
Name
(GenBank) multidrug resistance protein A, drug resistance transporter
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl HlyD_2 CusB_dom_1 DUF6672 DUF2118 PASTA Peptidase_M23 DUF3221 SurA_N_3
Other DBs
NCBI-ProteinID: ABD20902
UniProt: A0A0H2XF16
Position
complement(2471697..2472344)
AA seq 215 aa
MKKMILINVITVVVLLAIGIAGFYFWNKTTSYVTTDNAKVNGDQIKIASPASGQIKSLNV
KQGDKLDKGDKVAIVTVQGQDGETKDMDLKMPQKGTIAKLDGMEGSMVQAGNPIAYAYNL
DDLYVTANIDEKDIKDVEVGKDVDVTIDGQKASIKGKVDSIGKATAASFSLMPSSNSDGN
YTKVSQVIPVKITLESEPSKQVVPGMNAEVKIHKN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaaaaagatgatattaattaatgtcattacggttgttgtactgttagcaattgggatt
gctggcttttatttttggaataaaacaacaagctatgtaacaactgataatgcaaaagta
aatggcgatcaaattaaaatagcaagtcctgcatctggacaaattaaatcacttaatgtt
aaacaaggtgacaaactcgataaaggtgacaaagtagcaattgttactgtacaaggtcaa
gatggcgaaacgaaagatatggatcttaaaatgcctcaaaaaggtacaattgccaaatta
gatggtatggaaggttcaatggtgcaagctggtaacccaatcgcttatgcatacaattta
gatgatttatatgtaacagcaaatattgacgaaaaagatattaaagatgttgaagtaggt
aaagatgttgatgtgactattgacggtcaaaaagcttctattaaaggtaaagttgatagt
attggaaaagcaactgctgcaagcttttcattaatgccatcatcaaatagtgatggtaac
tacactaaagtttctcaagtaatacctgttaaaatcactctagaatcagaaccgtctaaa
caagttgttcctggaatgaacgctgaagtaaaaatccataaaaattaa

DBGET integrated database retrieval system