KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_2300
Entry
SAUSA300_2300     CDS       T00323                                 
Name
(GenBank) transcriptional regulator, TetR family
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
SSDB
Motif
Pfam: TetR_C_8 TetR_N HTH_Tnp_1_2 HTH_23
Other DBs
NCBI-ProteinID: ABD22810
UniProt: A0A0H2XKE9
Position
2472465..2473016
AA seq 183 aa
MKRQAKIEIQNALVDLMAEYPFQEISTKMICAYCNINRSTFYDYYKDKFDLLDTINSKHK
EKFQFLLSALHHNFENIKQDKLKLYKFFIIIAKYIKHNEQFFKDILVTYPMKTLFIDYIN
LARDYYQQIMNDYSTTVTNKQLYVTYIIGGQAGVFINWLSNGCNESPEEVADILLANTIK
LQN
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaaacgacaagccaaaatagaaattcaaaacgcacttgttgatttgatggctgaatat
ccttttcaagaaatatccactaaaatgatttgcgcgtattgtaatattaatcgttctact
ttttatgattattacaaagataaatttgatttattggataccatcaactcaaagcataag
gaaaaattccaatttcttctaagcgcgctacatcataatttcgaaaatattaaacaggat
aagcttaaactttataaattcttcattattattgctaagtatatcaagcacaatgagcag
tttttcaaagacattttagttacctatccaatgaaaacattattcatagactatataaat
ttagcgagagattactatcaacaaattatgaatgactatagtactacagtaaccaataaa
cagctttatgttacatatatcataggcggtcaagctggggtgtttattaattggctttcg
aatggttgtaatgaatcacctgaagaagttgctgacattttattggctaatacgattaaa
cttcaaaactaa

DBGET integrated database retrieval system