KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_2301
Entry
SAUSA300_2301     CDS       T00323                                 
Symbol
tcaB
Name
(GenBank) teicoplanin resistance associated membrane protein TcaB protein
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:saa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:saa02000]
    SAUSA300_2301 (tcaB)
Transporters [BR:saa02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    SAUSA300_2301 (tcaB)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_3
Other DBs
NCBI-ProteinID: ABD22413
UniProt: A0A0H2XI25
Position
complement(2473246..2474454)
AA seq 402 aa
MNDLTHFNKRSPIFIIILGSLTAIGALSIDMFLPGLPDIRHDFQTTTSNAQLTLSMFMIG
LAFGNLFAGPISDSTGRRKPLIIAMIIFTLASLGIVFVHNIWLMVALRFLQGVTGGAAAV
ISRAIASDMYSGNELTKFMALLMLVNGIAPVVAPTIGGIILNYSVWRMVFVILTIFGFVM
VIGSLLKVPESLTVTNRESSSGLKTMFKNFKILLKTPRFVLPMLIQGMTFVILFTYISAS
PFIIQKIYGMTAIQFSWMFAGIGITLIISSQLTGYLVDFIDSQKLMRGMTMIQIIGVILV
TIVLLNHWNFWILAIGFIILIAPVTGVATLGFTIAMDESSSGRGSSSSLLGLVQFLFGGV
ASPLVGVKGEDNPIPYIIIIIATAVILIILQIYNMKVFKTNR
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgaatgatttaacgcattttaacaagcgttcaccgatatttattattattttaggatct
ttgacggccattggagcattatcgatagatatgtttttgcctggattaccagatattaga
catgattttcaaacaacgacgtctaacgcacaattaacattatcgatgtttatgattggt
ttagcgtttggtaatttgtttgctggtccaatttcagattcaactgggcgcagaaagccg
cttattatagctatgattatttttacattagcaagtttaggtattgtttttgtacataat
atttggctgatggttgcattaagatttcttcaaggagtgacaggtggcgcagcagcagtt
atttcaagagctatagcaagtgatatgtatagtggtaatgaactaactaagtttatggca
ttattgatgcttgttaatggtattgcaccagttgttgcgccaacaatagggggcataatt
ttaaattattctgtctggcgtatggtctttgtcattctgactatctttggcttcgtcatg
gtcataggttctttattaaaagtacctgaatcattaacagtgacaaatcgtgagtcaagt
agtggattaaagacaatgtttaaaaacttcaaaatattattgaagacgccacgttttgta
ttaccaatgctcattcaaggtatgacatttgtaatattatttacttatatttctgcgtct
ccgtttattattcaaaaaatttatggcatgactgcaatacaatttagttggatgtttgca
ggaattggtattacgctcattatatcaagtcaacttactgggtaccttgttgattttata
gactcacaaaaattgatgagaggcatgacgatgattcagattatcggtgtaattttagtg
acgattgtattgcttaatcattggaacttttggattttagcgataggatttatcatttta
atagcaccagtgacaggtgttgcgacacttggttttacaatagctatggatgaaagtagt
agtggtagagggagttcatcaagtttattaggtttagtacagtttttatttggtggtgtt
gcatcgccattagtgggggtaaaaggtgaagataatcctataccttacataattattatt
atagctacagcagttatattaattattttacagatttataatatgaaggtatttaaaaca
aatcgatga

DBGET integrated database retrieval system