KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0046
Entry
SAUSA300_0046     CDS       T00323                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
SSDB
Other DBs
NCBI-ProteinID: ABD20945
UniProt: A0A0H2XF21
Position
56989..57609
AA seq 206 aa
MKFTEVEVIEHLVKAYKEAGKPTYPHENLYRGRNHSISGIGEDLLGAYLISRLEGVQIFI
DQPLSMIDKSLSTRYPDLLICEDNEIKNILEVKMDLGYQRKDFIDYCRKKEEWISNIVGK
QCVLSRKREDKIPMNIADDIKFHVVIYSENNGPKRFDEEIMPIVNETCPHIEVYVLTSGQ
HPNLVNVNLEGININKDEFEILVNAL
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaaattcactgaagtggaagttatcgaacatcttgtaaaggcatataaagaagcagga
aagcctacttatcctcatgaaaatttatatcgaggacgtaatcatagtatttcaggtatt
ggagaagacttgctgggtgcttatttgattagtagattggaaggtgtccaaatatttatt
gatcagcctttatctatgattgataaatctttaagtacaagatatccggatttattaatt
tgtgaagataatgaaattaaaaatatactagaagttaaaatggacttaggatatcaaaga
aaagattttatagattattgccgaaagaaagaagaatggatttcaaatatcgtaggaaaa
cagtgtgtattgtctagaaagagagaagacaaaattcctatgaatatagctgatgatatt
aaatttcatgttgtgatttacagtgaaaacaatggaccgaagcggtttgatgaagaaatc
atgcctatcgttaatgaaacatgtccacatattgaagtatatgtcctaacaagcggtcaa
caccctaatttagtaaatgttaatcttgaaggtattaatattaataaagatgaatttgaa
atattagtaaatgcgttataa

DBGET integrated database retrieval system