KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0301
Entry
SAUSA300_0301     CDS       T00323                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
SSDB
Motif
Pfam: DUF600 Chalcone
Other DBs
NCBI-ProteinID: ABD22266
UniProt: A0A0H2XJA6
Position
351673..352173
AA seq 166 aa
MTFEEKISKLYNEIANEISSMIPVEWEKVYTMAYIDDGGGEVFFNYTKPGSDDLNYYTDI
PKEYNISVQVFDDLWMDLYDLFEELRDLFKEEGLEPWTSCEFDFTSEGKLKVSFDYIDWI
NTEFDQLGRENYYMYKKFGVLPEMEYEMEEIKEIDQYIKEQDEAEI
NT seq 501 nt   +upstreamnt  +downstreamnt
atgactttcgaagagaaaataagcaaattatataatgagattgcgaatgagattagcagt
atgataccggtagagtgggaaaaagtatatacaatggcttatatagatgatggaggaggt
gaagtattctttaattatactaaaccaggtagtgatgacttgaattattacaccgatata
cctaaggagtataacatctctgtgcaagtatttgatgatttatggatggatttatatgat
ttgtttgaggaattaagagatttatttaaagaagaaggacttgaaccatggacatcatgt
gaatttgactttacaagcgaaggtaaattaaaagtttcatttgattatatagattggata
aatacagagtttgatcaattaggccgtgaaaattattatatgtataaaaaatttggggtt
ttaccagaaatggaatatgaaatggaagaaattaaagaaatcgatcaatatattaaagag
caagatgaagctgaaatatag

DBGET integrated database retrieval system