KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_0560Help
Entry
SAUSA300_0560     CDS       T00323                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA c-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00071  Fatty acid degradation
saa00072  Synthesis and degradation of ketone bodies
saa00280  Valine, leucine and isoleucine degradation
saa00310  Lysine degradation
saa00362  Benzoate degradation
saa00380  Tryptophan metabolism
saa00620  Pyruvate metabolism
saa00630  Glyoxylate and dicarboxylate metabolism
saa00640  Propanoate metabolism
saa00650  Butanoate metabolism
saa00900  Terpenoid backbone biosynthesis
saa01100  Metabolic pathways
saa01110  Biosynthesis of secondary metabolites
saa01120  Microbial metabolism in diverse environments
saa01130  Biosynthesis of antibiotics
saa01200  Carbon metabolism
saa01212  Fatty acid metabolism
saa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAUSA300_0560 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SAUSA300_0560 (vraB)
   00640 Propanoate metabolism
    SAUSA300_0560 (vraB)
   00650 Butanoate metabolism
    SAUSA300_0560 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAUSA300_0560 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SAUSA300_0560 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAUSA300_0560 (vraB)
   00310 Lysine degradation
    SAUSA300_0560 (vraB)
   00380 Tryptophan metabolism
    SAUSA300_0560 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAUSA300_0560 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAUSA300_0560 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAUSA300_0560 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saa04147]
    SAUSA300_0560 (vraB)
Enzymes [BR:saa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAUSA300_0560 (vraB)
Exosome [BR:saa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAUSA300_0560 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABD22695
UniProt: A0A0H2XIB7
Position
634656..635795
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaattg
acagcggaaaatgtaaaaaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtgatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system