KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_1267Help
Entry
SAUSA300_1267     CDS       T00323                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00260  Glycine, serine and threonine metabolism
saa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
saa01100  Metabolic pathways
saa01110  Biosynthesis of secondary metabolites
saa01130  Biosynthesis of antibiotics
saa01230  Biosynthesis of amino acids
Module
saa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:saa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAUSA300_1267 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAUSA300_1267 (trpB)
Enzymes [BR:saa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAUSA300_1267 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABD20758
UniProt: Q2FH64
Position
1394789..1396003
Genome map
AA seq 404 aa AA seqDB search
MNKQIQTEADELGFFGEYGGQYVPETLMPAIIELKKAYKEAKADPEFQRELEYYLSEYVG
RATPLTYAASYTESLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAG
QHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQGTLSDAVNKA
LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEGRLPDAIVACIGG
GSNAIGTFYPFIKDDVALYGVEAAGQGDDTDKHALAIGKGSPGVLHGTKMYLIQDEDGQV
QLAHSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHA
LSYVERLAPTMSKEDIIVVTISGRGDKDMETIRQYMVERGLAND
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaaatacaaacagaagcagatgaattaggtttctttggtgaatatggaggg
caatatgttccagaaacattaatgccagcaattattgagttgaaaaaagcttataaagag
gcaaaagcagacccagagtttcaaagagaactggaatactatttatcagagtatgtagga
cgcgcgacaccacttacatatgctgcatcatatactgaaagcctaggtggcgctaaaata
tatttgaaacgagaggatctaaatcatacaggcgcccataaaattaataatgcgttaggt
caagcgttgcttgctaaaagaatgggcaagaagaagcttgttgctgaaactggtgcgggt
caacatggtgtagctagtgctacggttgctgcattatttgatatggaacttgttgtcttt
atgggaagtgaagatattaaaagacaacaacttaatgtatttagaatggaattacttggt
gcaaaggttgtggcagttgaagatggtcaagggactttatcggatgcagttaataaagca
ttgcaatattgggtaagtcatgtagatgatacacattatttattaggttctgcattaggt
ccagacccgttcccaacgattgttagagattttcagagtgtgattggtaaagaaataaaa
tcacagatattgaagaaagaaggtcgacttccggatgcaattgtagcatgtatcggtggt
ggctcaaatgcaatcggtacattttatccatttattaaagatgatgttgcattatacggt
gttgaagccgcaggtcaaggcgatgatactgataaacatgcacttgcaattggcaaagga
tcacctggcgtattacatggtactaaaatgtatttaattcaagatgaagatgggcaagtg
caactagcacattctatttcagcaggacttgattatcctggtattggaccagaacattct
tattaccacgacattggtagagtaacttttgaaaatgctagtgatacacaagcaatgaat
gctttaatcaactttacaaaacatgaaggtattatacctgcaattgaaagtgcacatgca
ctgagttatgttgaaagactagcgcctacgatgtcgaaagaagatattattgtagtaact
atttctggacgtggcgataaagatatggaaacaattagacaatatatggtagagcgaggt
cttgcaaatgactaa

DBGET integrated database retrieval system