KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_1382
Entry
SAUSA300_1382     CDS       T00323                                 

Gene name
lukS-PV
Definition
(GenBank) Panton-Valentine leukocidin, LukS-PV
  KO
K11038  leukocidin/hemolysin toxin family protein
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:saa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    SAUSA300_1382 (lukS-PV)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:saa02000]
    SAUSA300_1382 (lukS-PV)
   02042 Bacterial toxins [BR:saa02042]
    SAUSA300_1382 (lukS-PV)
Transporters [BR:saa02000]
 Other transporters
  Pores ion channels [TC:1]
   SAUSA300_1382 (lukS-PV)
Bacterial toxins [BR:saa02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Beta-pore-forming/Cholesterol-dependent
   SAUSA300_1382 (lukS-PV)
SSDB
Motif
Pfam: Leukocidin
Other DBs
NCBI-ProteinID: ABD22441
UniProt: A0A0H2XI46
Position
complement(1547149..1548087)
AA seq 312 aa
MVKKRLLAATLSLGIITPIATSFHESKADNNIENIGDGAEVVKRTEDTSSDKWGVTQNIQ
FDFVKDKKYNKDALILKMQGFINSKTTYYNYKNTDHIKAMRWPFQYNIGLKTNDPNVDLI
NYLPKNKIDSVNVSQTLGYNIGGNFNSGPSTGGNGSFNYSKTISYNQQNYISEVERQNSK
SVQWGIKANSFITSLGKMSGHDPNLFVGYKPYSQNPRDYFVPDNELPPLVHSGFNPSFIA
TVSHEKGSGDTSEFEITYGRNMDVTHATRRTTHYGNSYLEGSRIHNAFVNRNYTVKYEVN
WKTHEIKVKGHN
NT seq 939 nt   +upstreamnt  +downstreamnt
atggtcaaaaaaagactattagctgcaacattgtcgttaggaataatcactcctattgct
acttcgtttcatgaatctaaagctgataacaatattgagaatattggtgatggcgctgag
gtagtcaaaagaacagaagatacaagtagcgataagtggggggtcacacaaaatattcag
tttgattttgttaaagataaaaagtataacaaagacgctttgattttaaaaatgcaaggt
tttatcaattcaaagactacttattacaattacaaaaacacagatcatataaaagcaatg
aggtggcctttccaatacaatattggtctcaaaacaaatgaccccaatgtagatttaata
aattatctacctaaaaataaaatagattcagtaaatgttagtcaaacattaggttataac
ataggtggtaattttaatagtggtccatcaacaggaggtaatggttcatttaattattca
aaaacaattagttataatcaacaaaactatatcagtgaagtagaacgtcaaaattcaaaa
agtgttcaatggggaataaaagctaattcatttatcacatcattaggtaaaatgtctgga
catgatccaaatttatttgttggatataaaccatatagtcaaaatccgagagactatttt
gttccagacaatgaattacccccattagtacacagtggtttcaatccttcatttattgca
actgtttctcatgaaaaaggctcaggagatacaagtgaatttgaaataacgtatggcaga
aatatggatgttactcatgctactagaagaacaacacactatggcaatagttatttagaa
ggatctagaatacacaacgcatttgtaaacagaaattacacagttaaatatgaagtgaac
tggaaaactcatgaaattaaagtgaaaggacataattga

DBGET integrated database retrieval system