KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_1481Help
Entry
SAUSA300_1481     CDS       T00323                                 

Definition
(GenBank) putative membrane protein
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABD21091
UniProt: A0A0H2XEV4
Position
complement(1634116..1635963)
Genome map
AA seq 615 aa AA seqDB search
MKHKSVYLLCFLILPILLLTSVSAYAVSNPVGEPSHAVKPKIEKYDLSHYRSIYSEKGDW
NPFGQEEISRQINNVSDFFFSMTKILAGVTDYAIENLFQLDVINDFADKIGDFVGDIYQK
LLSNLALTLFIIVCFNAFIIFSVQGNAREALKRAFLIMCLIGFGVGILANAGNIIRGTNN
IGKDLNNIIMNSTSSIDGNIDYIHENSGMNHIRNQLFDMTIYRTYLVMNYGTVDEKEIKA
KGKDRIDNILKLDYDKKSEKELDDIVKDEVEKKNNKYMTQGYVFQKLAISVIGFIITLFM
SIVFLSISFAKLIFSTFALFLFLFLVFSWIVSFIPGFELSVFSAFAKTLGYIILSACMTF
LFVIVGLCIKLANSFIEPDSQNAYFLNSIFIIVILFVMYKKRAQIINFVSRGNISFSPSA
IGAGVMNRTQERFNKIRHEQAQNKKAKRENQRDEPAPPLQNDNDLRRRQQDKPMPLFINK
DNQKNGNKRREQQESMNGNDVKSASVESNANNYSKQPQKASQQEHQVRETRQRKDIQRSP
QVVNQPLNNENHSINRKEQKSVQTAYDTDVQKRQIQNATQNQQSRQSGNRNQPITRNSQS
KDRLKEQKDINKHGK
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgaagcataaaagtgtgtatcttttatgctttttaattttgcctattctgcttttaaca
tctgtgagtgcttatgctgtttctaatccagttggagagccctcacatgcagttaagcca
aaaattgaaaagtatgatttatcacattatcgttcaatatatagtgaaaaaggcgactgg
aatccgtttggtcaagaagaaatttcacgtcaaattaataatgtgtcagattttttcttt
tctatgactaagattttagcaggtgttacagattatgcgattgaaaatttatttcaatta
gatgttattaatgattttgcggataaaatcggcgattttgttggcgatatatatcaaaag
ttattgagtaatttagcattaacattatttattattgtttgttttaacgcatttattatt
tttagtgtacaaggtaatgcaagagaagcattaaaacgagcgtttttaattatgtgttta
attggttttggtgttggtatacttgcgaatgcaggtaatattatacgtggtacaaacaat
attggtaaggacttaaataatataattatgaatagtacatcttctattgatggtaatatt
gattatattcatgagaattcaggtatgaatcatatacgtaatcaattatttgatatgacg
atatatagaacatatttagtaatgaattatggaactgtcgacgaaaaagagataaaagca
aaaggtaaagaccgtattgataacattttaaaacttgattatgataaaaaatcagaaaaa
gaattagatgatattgttaaagatgaggttgaaaagaaaaataataaatatatgacgcaa
ggttatgtatttcaaaagttggctatttcagtgattggttttattattacactttttatg
tcgatagtatttttatcaataagttttgcgaagttgattttttctacatttgctttattt
ttattcttatttttagtattcagttggatagtgagttttataccaggatttgaattatct
gttttctctgcgtttgcaaaaacgttaggctatattattttaagtgcttgtatgacattc
ttatttgtgatagttggtttgtgtatcaagcttgcaaatagttttattgaaccggatagt
caaaatgcttattttttaaattcaatatttataattgtaatattgtttgtaatgtataaa
aaacgggctcaaattatcaattttgtaagtcgtggtaatattagtttttctcctagtgca
attggtgctggtgtgatgaatcgaacacaagaacgttttaataagattcgtcatgaacaa
gcgcaaaataagaaagctaaacgagaaaatcaaagagatgaacccgccccaccacttcaa
aatgataatgatttaagaagaagacaacaggataaaccaatgcctttatttataaataaa
gataatcaaaaaaatggtaataagcgcagagaacaacaagagtcaatgaatggtaacgat
gtaaaatctgcttctgttgaatcaaatgcaaataattattctaaacaaccacaaaaagca
tcacagcaagaacatcaagtacgagaaacaagacagcgaaaagatatacaaaggtcgcca
caagtggttaatcagccattaaataatgagaatcattcaataaatcgtaaagaacagaag
tcagttcaaactgcttatgatactgatgttcaaaaacgacaaatacaaaatgcgacacag
aatcaacaaagtagacaatctggaaatcgtaatcaacctattacgcgtaattctcagtca
aaagaccgtttaaaagagcaaaaggatatcaataagcatggtaaataa

DBGET integrated database retrieval system