KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_1678Help
Entry
SAUSA300_1678     CDS       T00323                                 

Gene name
fhs
Definition
(GenBank) formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00670  One carbon pool by folate
saa01100  Metabolic pathways
saa01120  Microbial metabolism in diverse environments
saa01200  Carbon metabolism
Module
saa_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:saa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAUSA300_1678 (fhs)
Enzymes [BR:saa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     SAUSA300_1678 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS POTRA_TamA_1 CbiA
Motif
Other DBs
NCBI-ProteinID: ABD21556
UniProt: Q2FG06
Position
complement(1847198..1848865)
Genome map
AA seq 555 aa AA seqDB search
MTHLSDLDIANQSTLQPIKDIAASVGISEDALEPYGHYKAKIDINKITPRENKGKVVLVT
AMSPTPAGEGKSTVTVGLADAFHELNKNVMVALREPALGPTFGIKGGATGGGYAQVLPME
DINLHFNGDFHAITTANNALSAFIDNHIHQGNELGIDQRRIEWKRVLDMNDRALRHVNVG
LGGPTNGVPREDGFNITVASEIMAILCLSRSIKDLKDKISRITIGYTRDRKPVTVADLKV
EGALAMILKDAIKPNLVQSIEGTPALVHGGPFANIAHGCNSILATETARDLADIVVTEAG
FGSDLGAEKFMDIKVREAGFDPAAVVVVATIRALKMHGGVAKDNLKEENVEAVKAGIVNL
ERHVNNIKKFGVEPVVAINAFIHDTDAEVEYVKSWAKENNVRIALTEVWKKGGKGGVDLA
NEVLEVIDQPNSFKPLYELELPLEQKIEKIVTEIYGGSKVTFSSKAQKQLKQFKENGWDN
YPVCMAKTQYSFSDDQTLLGAPSGFEITIRELEAKTGAGFIVALTGAIMTMPGLPKKPAA
LNMDVTDDGHAIGLF
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
ttgactcatttatcagatttagatattgcgaatcaatcaacactacaaccaattaaggat
attgctgcatcagtaggtatttcagaggatgcattagaaccttatggtcattacaaagct
aaaatcgacattaataaaattacgccaagagaaaacaaagggaaagttgttttagtaact
gcgatgagcccaacaccagctggtgaaggtaaatcaacggttacagttggtttagctgat
gcattccatgagttaaataaaaacgttatggttgcattaagagagcctgctttaggacca
acatttggtatcaaaggtggtgcgactggtggtggttatgcgcaagtcttacctatggaa
gatatcaacttacatttcaacggagatttccatgcgattacaactgcaaataatgcattg
tctgcgtttatcgataatcatattcaccaaggtaacgaattaggaatcgatcaaagacgt
attgagtggaaacgtgtattagatatgaatgatcgtgcacttagacatgtaaacgttggg
ttaggtggacctacaaatggtgtaccacgtgaagatggctttaatattacagtagcgtct
gaaattatggcgattttatgtttaagtagaagtattaaagacttaaaagataaaattagt
cgtattactattggttacactagagatcgcaagccagttacagttgcagatttaaaagtg
gaaggtgcacttgcaatgattttaaaagatgcaataaaaccaaacttagtacaatcaatt
gaagggacacctgcattagttcatggtggaccatttgcgaatatcgcacacggttgtaac
tcaattttagcaactgaaacagcacgtgatttagctgatatcgttgtaacggaagctgga
tttggttcagacttaggcgctgaaaaattcatggacattaaagtgcgtgaagcaggattt
gatccggcagctgtcgttgttgttgcgacaattcgtgcgttaaaaatgcatggtggtgta
gcgaaagataatttaaaagaagaaaatgtagaagcagtaaaagcaggaattgttaattta
gagcgtcatgttaataatattaaaaaattcggtgtagaaccggttgttgcaattaatgca
tttatacatgataccgatgcagaagtagaatatgtaaaatcttgggctaaagaaaataac
gtacgaattgccttaactgaagtttggaaaaaaggtggtaaaggtggcgttgacttagca
aatgaagtattagaagtcattgatcaacctaattcatttaaacctttatatgaattagaa
ttaccattagagcaaaagattgaaaagattgtgactgaaatctatggcggttcaaaagta
acgtttagcagtaaagcgcaaaaacaattaaaacaatttaaagaaaatggttgggataat
tacccagtatgtatggcgaaaacacaatattcattctcagatgatcaaacgttgttaggt
gcaccatcaggatttgaaattacaattcgtgaattagaagcgaaaacaggtgcaggattt
atcgtagcgttgacaggtgcaatcatgactatgcctggtttacctaaaaaaccagcagca
ttaaacatggatgttactgatgatggtcatgcaattgggttattctaa

DBGET integrated database retrieval system