KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_2292
Entry
SAUSA300_2292     CDS       T00323                                 

Gene name
fni
Definition
(GenBank) isopentenyl-diphosphate delta-isomerase
  KO
K01823  isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00900  Terpenoid backbone biosynthesis
saa01100  Metabolic pathways
saa01110  Biosynthesis of secondary metabolites
Module
saa_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:saa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAUSA300_2292 (fni)
Enzymes [BR:saa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     SAUSA300_2292 (fni)
SSDB
Motif
Pfam: FMN_dh Glu_synthase IMPDH
Other DBs
NCBI-ProteinID: ABD20739
UniProt: Q2FEF1
Position
complement(2464602..2465651)
AA seq 349 aa
MSDFQREQRKNEHVEIAMAQSDAMHSDFDKMRFVHHSIPSINVNDIDLTSQTPDLTMAYP
VYINAMTGGSEWTKNINEKLAVVARETGLAMAVGSTHAALRNPRMAETFTIARKMNPEGM
IFSNVGADVPVEKALEAVELLEAQALQIHVNSPQELVMPEGNREFVTWLDNIASIVSRVS
VPVIIKEVGFGMSKELMHDLQQIGVKYVDVSGKGGTNFVDIENERRANKDMDYLSSWGQS
TVESLLETTAYQSEISVFASGGLRTPLDAIKSLALGAKATGMSRPFLNQVENNGIAHTVA
YVESFIEHMKSIMTMLDAKNIDDLTQKQIVFSPEILSWIEQRNLNIHRG
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgagtgattttcaaagagaacagagaaaaaatgaacatgttgaaatagcaatggcccaa
tctgacgcaatgcattcagattttgataagatgcgttttgtgcatcattctatcccatca
attaatgtaaatgatatcgatttgacatcacagacgcctgacttaacgatggcatatccg
gtttatattaatgcaatgacgggtggtagcgagtggacgaaaaacatcaatgaaaagcta
gctgtagttgcaagagaaactggcttagcgatggcagttggatcaacacatgcggcattg
agaaatccacgcatggctgagacgtttacgattgcgcgaaaaatgaatcctgaaggcatg
atttttagcaatgttggtgcggacgtaccagtagaaaaggctttggaagcagttgaatta
cttgaggcacaagcgttacaaatccatgttaattctcctcaagaattagttatgcctgaa
gggaatcgtgaatttgtgacttggttagataatatagcgtcgattgtatcacgagtgtct
gttccagtcattataaaagaagttggatttggtatgagcaaagaattaatgcatgactta
caacaaataggcgtcaagtatgtcgatgttagtggcaaaggtggtactaactttgtagat
attgaaaatgaacgtcgtgcaaataaagatatggattacttatcatcatggggacagtct
acagttgagtcattacttgaaacaacggcttatcaaagcgaaatttcagttttcgcgagt
ggtggtttacgtacaccactcgatgcaattaaaagtttagcacttggtgcaaaggcaact
ggtatgtcacgtccgtttttaaatcaagttgaaaataatggcattgcacatacagtagct
tatgtagaatcatttattgaacacatgaaatcaataatgacgatgttagatgctaaaaat
attgacgacttaacacaaaaacaaatcgtatttagtccggaaatattgtcatggatagaa
caacgtaacttgaatatacatcgaggataa

DBGET integrated database retrieval system