KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_2370Help
Entry
SAUSA300_2370     CDS       T00323                                 

Definition
(GenBank) putative 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
Pathway
saa00780  Biotin metabolism
saa01100  Metabolic pathways
Module
saa_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
saa_M00577  Biotin biosynthesis, BioW pathway, pimelate => pimeloyl-CoA => biotin
Brite
KEGG Orthology (KO) [BR:saa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SAUSA300_2370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:saa01007]
    SAUSA300_2370
Enzymes [BR:saa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     SAUSA300_2370
Amino acid related enzymes [BR:saa01007]
 Aminotransferase (transaminase)
  Class II
   SAUSA300_2370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Cas_DxTHG DegT_DnrJ_EryC1 Peptidase_C10 DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ABD21849
UniProt: A0A0H2XIR1
Position
complement(2546782..2547897)
Genome map
AA seq 371 aa AA seqDB search
MKFQEQIDLLQQKGLYRSLKSVGYIDRQYIEVENKRCTNYTSNDYLGLGQIAFDKDDFER
FMRKYSYHLSSSRLISGSSTAYEEIETMLAGWLGYSACTILNSGYDANLALFNIFKNTNC
VVFSDQENHASIIDGIKLSGLEKVIYKHLDIADLEKRLEKYPNQNIPKIIISDSVFSTNG
DVVDIGQLVSLKHKYNATLILDVSHSFGIENYSNYQGVDILTSSLSKACGAYGGVILSSN
DVKDMLINHGRPLIYSSSLPIYNLYFIKRNIEKLINADDRRTKLNSLSKYFNQKLKALNV
NYNSSNSPIKFIEFDDIEAAENIHQTLLKHHVFTSYLRYPTVTKPMLRISLSYFHTEQDI
DRLFEILHQED
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttcaagagcaaattgatttattacaacagaaagggttatatcggtcgcttaaa
tcggtagggtatatagatagacagtatattgaagtagaaaataagagatgtacgaactat
acatctaatgattatttaggattaggtcaaatagcgtttgataaggatgatttcgaaaga
tttatgcggaagtatagttatcacttatcaagttcaagattaattagtggaagttcgaca
gcttatgaagaaattgaaacaatgttagcaggttggctcggatatagtgcatgtactatc
ttaaatagtggttatgatgctaatttggcgttatttaatattttcaaaaatacaaattgt
gtcgtgttttcagatcaagaaaatcatgcgagtattattgacggtattaagttaagtggt
ttagaaaaagtgatatataagcatttagatattgctgatttagaaaaaaggttagagaaa
taccctaatcaaaatataccaaaaataatcatatctgatagtgtattttcaacgaatggc
gacgttgtggatattggtcaattagtctcattaaagcataaatataacgcaacactgata
ctcgatgtttcacatagttttggaatagagaattactcgaattatcaaggtgtagatata
ctcacttctagtttatctaaagcatgtggtgcatacgggggtgtgattttaagttcaaat
gatgtgaaggatatgttaattaatcacggtagaccactcatctactcaagtagtttgcca
atttataatttgtattttataaaaagaaacattgaaaagttaataaatgctgatgataga
cgcactaaattaaatagtttgagtaaatattttaaccaaaagttaaaagcactcaatgtt
aattataatagttcaaactcgccgattaagtttattgagtttgatgacatagaagcggct
gagaacattcatcaaacattattaaagcatcatgtgtttacaagttatttaaggtatcca
actgtgactaagccaatgttaagaatatcattgtcgtattttcatactgaacaagatata
gataggttgtttgaaattttgcatcaagaagattga

DBGET integrated database retrieval system