KEGG   Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA): SAUSA300_pUSA0312
Entry
SAUSA300_pUSA0312 CDS       T00323                                 

Gene name
traC
Definition
(GenBank) membrane protein TraC
Organism
saa  Staphylococcus aureus subsp. aureus USA300_FPR3757 (CA-MRSA)
SSDB
Motif
Pfam: PrgI Phage_holin_3_6 DUF2207 DUF2149 Myc_target_1 AA_permease_C
Other DBs
NCBI-ProteinID: ABD22942
UniProt: A0A0H2XIT4
Position
pUSA03:11407..11814
AA seq 135 aa
MSVEQEVKDIMLDMLGEEKKVKENIIPRNVDASYKIFLNLNGKELAIVFVPFLLFLTIAF
GVTFLMGLLNLITGFMVFIVGLIFGLTIYGLLTIRPISTKENIRMIDTIKQSQRFSRRQK
VYFYKSKEGLGDDDV
NT seq 408 nt   +upstreamnt  +downstreamnt
atgtctgttgagcaagaagttaaagatataatgctcgatatgttgggcgaagaaaagaaa
gttaaagagaatataatacctcgtaatgtagacgctagttataaaatattcttaaattta
aacggtaaagaattagcaattgtatttgttccttttttactatttctaacaatagcattt
ggtgtaacgtttttaatgggcttacttaatttaataactggctttatggtttttatagta
ggtttgatttttggtttaacaatatatggcttactaacaattagaccaattagtacaaaa
gaaaatataagaatgattgataccataaaacaatcacaacgatttagcagaaggcagaaa
gtttacttctataaaagtaaagaaggattgggtgatgatgatgtttaa

DBGET integrated database retrieval system