KEGG   Staphylococcus aureus RF122: SAB1100
Entry
SAB1100           CDS       T00303                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09787  uncharacterized protein
Organism
sab  Staphylococcus aureus RF122
Brite
KEGG Orthology (KO) [BR:sab00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SAB1100
SSDB
Motif
Pfam: UPF0122 Sigma70_r4 Sigma70_r4_2 HTH_38 HTH_11 HTH_23 Sigma70_ECF HTH_Tnp_1_2 HTH_7 HTH_10 HTH_28 HTH_17 TrmB HTH_40 HTH_29 DUF1492 Terminase_5 HTH_22 GerE Syntaxin-6_N AAA_23
Other DBs
NCBI-ProteinID: CAI80789
UniProt: Q2YXI0
Structure
PDB: 
1XSV

Position
1189306..1189638
AA seq 110 aa
MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIR
RTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE
NT seq 333 nt   +upstreamnt  +downstreamnt
atggggcaaaatgatttagttaaaacgttacgaatgaattatttgtttgatttttatcaa
tccttattgacgaataaacaacgtaattatttggaattattttatctcgaagattattct
ttgagtgaaatcgcagatacttttaatgtgagtagacaagcagtttatgataatataaga
agaactggcgatttagttgaagattatgaaaagaaattggaattataccagaaatttgag
caacgccgagaaatatatgatgaaatgaaacaacatttaagtaatccagaacaaatacaa
cgttatattcaacaattagaagacttagaatag

DBGET integrated database retrieval system