KEGG   Staphylococcus aureus RF122: SAB1741c
Entry
SAB1741c          CDS       T00303                                 
Symbol
dnaB
Name
(GenBank) replicative DNA helicase
Organism
sab  Staphylococcus aureus RF122
SSDB
Motif
Pfam: DnaB_C AAA_25 ATPase divDNAB
Other DBs
NCBI-ProteinID: CAI81430
Position
complement(1875887..1877128)
AA seq 413 aa
MNYGQFEIESTIIATLLKQPDVLEKIRVKDYMFTNEKFKTFFNYVMDAGKIDHQEIYLKA
TKDKGFLDADTITKLYNSDFIGYGFFERYQQELLESYQLNKANELVTEFKQQPTNQNFNN
LIDELKDLKTITNKKEDGTKKFVEEFVEELYSDSPKKQIKTGYKLMDYKIGGLEPSQLIV
IAARPSVGKTGFALNMMLNIARNGYKTSFFSLETTGTSVLKRMLSTITGIELTKIKEIRN
LTPDDLTKLTNAMDKIMKLGIDISDKSNVTPQDVRAQAMRYSDEQQVIFIDYLQLMDTDA
KVDRRVAVEKISRDLKIIANETGAIIVLLSQLNRGVESRQDKRPMLSDMKESGGIEADAS
LAMLLYRDDYYNRDEDDGITGKSIVECNIAKNKDGETGIIEFEYYKKTQRFFT
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaattacggacaatttgaaattgaaagcactataatcgctacgctacttaaacaaccg
gacgtattagaaaagataagagttaaagattacatgtttacgaacgaaaagtttaaaacc
tttttcaattatgtaatggacgccggaaagatagatcatcaagaaatctatttaaaagca
actaaagataaagggtttttagatgcagatactatcactaaactttataactccgatttc
attggatacggattctttgaacgttaccaacaggaactattggaaagttatcaactcaac
aaagcaaacgaattggtcactgagttcaaacaacaacctacgaatcaaaactttaacaac
ttgattgatgaactcaaggatttaaaaacaattactaacaaaaaagaagatggaaccaag
aagtttgttgaggagtttgtcgaagagttatacagcgatagccctaagaagcaaattaag
acgggttacaagctcatggattacaaaatagggggattagagccatcacaattaatcgtc
atcgcagcgcgtccctcagtgggtaagacaggttttgcattaaacatgatgctgaacata
gcacgaaatggatataaaacatctttctttagtctcgaaacaactggcacatcagtattg
aaacgtatgttatcaacaattactggtattgagttaaccaagataaaagaaatcaggaac
ttaacgccggatgacttaacaaagttaacgaatgcgatggataaaatcatgaaattaggc
atcgatatttctgataaaagtaatgtcacaccgcaagatgtccgagcacaagcaatgagg
tactcagacgagcaacaagttatttttatagattatctccaactgatggatactgatgcg
aaagttgatagacgtgtagcagtagaaaaaatatcacgcgatttaaagataattgctaac
gagacgggcgcaatcatcgtactactttcacaactgaatcgtggtgttgagtctagacag
gataaaagaccaatgctatcggacatgaaagaatcaggcggaatagaagcagatgcgagt
ttagcaatgctactttaccgtgatgattactataaccgtgacgaagatgatggtatcaca
ggcaaatctattgttgaatgtaacatagccaaaaacaaagacggcgaaaccggaataatt
gaattcgagtattacaagaagacgcagaggtttttcacatga

DBGET integrated database retrieval system