KEGG   Staphylococcus aureus RF122: SAB2192
Entry
SAB2192           CDS       T00303                                 

Name
(GenBank) probable transcriptional regulator
Organism
sab  Staphylococcus aureus RF122
SSDB
Motif
Pfam: HTH_6 SIS SIS_2 DUF2529 HTH_Crp_2 FleQ Med25
Other DBs
NCBI-ProteinID: CAI81881
Position
2322394..2323266
AA seq 290 aa
MSNVLTEIDSQYPYMTKNEKKIAKFILNSPQKVIKMRSQDLASLLDISTSSVIRFSKKIT
DGGFHDLKINISKYVPKASSIYNVELMNNESTESLRTKLHTRTTRALNHANNELNDKTID
QICHCLKRSETIFIYGFGASFVVATDLYQKLSRIGLNIQLVQETHIFATLLATHNSNDSV
ILITNNGTQSEMQSMVKVIDDYHIPIITITSTRDNPVAQASNIVLTYGKTDENEMHMGAT
TSLFAQMFTIDILYYRYVALNYHASLDFITQSKMALDNYRKHLSNINFKH
NT seq 873 nt   +upstreamnt  +downstreamnt
atgtcaaacgtactaacagaaatagatagtcaatatccatatatgactaaaaatgaaaaa
aagatagctaaatttatactaaattcacctcaaaaggtgattaaaatgaggtctcaagac
ttagcaagcttattagatattagtacatcatcagtcattcgattcagcaagaaaattact
gatggcggttttcacgacttgaaaataaatatatctaaatatgttcctaaagcatcatca
atttacaatgttgaattaatgaataacgaaagcacagaatctttaagaactaaactccat
acacgtactacacgcgcacttaatcatgctaataacgaattaaatgataaaactattgat
caaatatgtcattgtttaaaacgttctgagacgatttttatatatggttttggcgcatct
tttgtagttgctaccgacttataccaaaagttatcaagaataggtcttaatattcaactt
gttcaagaaacacatatttttgcaacattattagcaactcacaattcgaacgacagtgtt
attcttattactaacaatggtacgcaaagtgaaatgcaatcaatggttaaagttattgat
gactaccatatacctataattacaattactagtacaagggataatcccgtagcacaggca
tcaaatattgttttaacttatgggaaaactgatgaaaatgagatgcatatgggagcaaca
acttcattatttgctcaaatgttcactattgatattttatattatcgttatgttgcatta
aattatcacgcatcattagatttcataacacaatctaaaatggctttagataactatcgt
aaacatttatcaaatattaactttaaacattaa

DBGET integrated database retrieval system