KEGG   Staphylococcus aureus RF122: SAB2228
Entry
SAB2228           CDS       T00303                                 
Name
(GenBank) hypothetical protein
Organism
sab  Staphylococcus aureus RF122
SSDB
Motif
Pfam: PRP9_N DUF3567 LMP COOH-NH2_lig MSP7_C
Other DBs
NCBI-ProteinID: CAI81917
Position
2356850..2357269
AA seq 139 aa
MTDALQQKIHIELLDLLDDVKFELTELNAQKGLYINGPANQLLKRGVHMAYVQGQKQAID
NIMTIVEQQLEDQHFLEHYDKFQNEVAHRNYDKTANFAELSDIPRQFDNFLDQFYQIKGQ
YFIITHINTLIGDFHSEAH
NT seq 420 nt   +upstreamnt  +downstreamnt
atgacagatgcattacaacaaaagattcatatcgaattactagatttattagatgatgtt
aagtttgaattaacagaattaaatgcacaaaaagggttatacattaacggaccagcaaat
cagctacttaagcgtggcgtgcatatggcttatgttcaaggacaaaagcaagctatcgat
aatattatgactattgtggaacaacagcttgaagatcaacatttcctagaacattatgat
aaatttcaaaatgaagttgctcatcgcaattatgataaaacagctaactttgcagaactt
agtgatattccacgtcaattcgataattttttagatcaattttatcaaattaaagggcaa
tactttatcatcacacatatcaatacacttattggtgattttcactcagaagctcattaa

DBGET integrated database retrieval system