KEGG   Staphylococcus aureus RF122: SAB0304Help
Entry
SAB0304           CDS       T00303                                 

Gene name
th1
Definition
(GenBank) probable acetyl-CoA acetyltransferase protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sab  Staphylococcus aureus RF122
Pathway
sab00071  Fatty acid degradation
sab00072  Synthesis and degradation of ketone bodies
sab00280  Valine, leucine and isoleucine degradation
sab00310  Lysine degradation
sab00362  Benzoate degradation
sab00380  Tryptophan metabolism
sab00620  Pyruvate metabolism
sab00630  Glyoxylate and dicarboxylate metabolism
sab00640  Propanoate metabolism
sab00650  Butanoate metabolism
sab00900  Terpenoid backbone biosynthesis
sab01100  Metabolic pathways
sab01110  Biosynthesis of secondary metabolites
sab01120  Microbial metabolism in diverse environments
sab01130  Biosynthesis of antibiotics
sab01200  Carbon metabolism
sab01212  Fatty acid metabolism
sab02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAB0304 (th1)
   00630 Glyoxylate and dicarboxylate metabolism
    SAB0304 (th1)
   00640 Propanoate metabolism
    SAB0304 (th1)
   00650 Butanoate metabolism
    SAB0304 (th1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAB0304 (th1)
   00072 Synthesis and degradation of ketone bodies
    SAB0304 (th1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAB0304 (th1)
   00310 Lysine degradation
    SAB0304 (th1)
   00380 Tryptophan metabolism
    SAB0304 (th1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAB0304 (th1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAB0304 (th1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAB0304 (th1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sab04147]
    SAB0304 (th1)
Enzymes [BR:sab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAB0304 (th1)
Exosome [BR:sab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAB0304 (th1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAI79992
UniProt: Q2YVF5
Position
353336..354517
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEINEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPVFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQKKAANAQQNGGFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattaatgaagtcatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gtatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgtt
aattctcagaaaaaggcggcaaatgcacaacaaaatggtggatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgttgtcactaaggatgaaggtgta
cgtgaaaatgtatcagttgaaaaattaagtcgcttaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgttgaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgtagatcgcgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagtcgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system