KEGG   Staphylococcus aureus RF122: SAB0526Help
Entry
SAB0526           CDS       T00303                                 

Definition
(GenBank) acetyl-CoA c-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sab  Staphylococcus aureus RF122
Pathway
sab00071  Fatty acid degradation
sab00072  Synthesis and degradation of ketone bodies
sab00280  Valine, leucine and isoleucine degradation
sab00310  Lysine degradation
sab00362  Benzoate degradation
sab00380  Tryptophan metabolism
sab00620  Pyruvate metabolism
sab00630  Glyoxylate and dicarboxylate metabolism
sab00640  Propanoate metabolism
sab00650  Butanoate metabolism
sab00900  Terpenoid backbone biosynthesis
sab01100  Metabolic pathways
sab01110  Biosynthesis of secondary metabolites
sab01120  Microbial metabolism in diverse environments
sab01130  Biosynthesis of antibiotics
sab01200  Carbon metabolism
sab01212  Fatty acid metabolism
sab02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAB0526
   00630 Glyoxylate and dicarboxylate metabolism
    SAB0526
   00640 Propanoate metabolism
    SAB0526
   00650 Butanoate metabolism
    SAB0526
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAB0526
   00072 Synthesis and degradation of ketone bodies
    SAB0526
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAB0526
   00310 Lysine degradation
    SAB0526
   00380 Tryptophan metabolism
    SAB0526
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAB0526
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAB0526
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAB0526
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sab04147]
    SAB0526
Enzymes [BR:sab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAB0526
Exosome [BR:sab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAB0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF4159
Motif
Other DBs
NCBI-ProteinID: CAI80214
Position
592701..593840
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHIEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYSCRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENAAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELDFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggaggcact
ttaaaacatatagagccagaacaattgctcaaacctttattccaacattttaaagagaag
tatccagaagtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatattcatgtcgcatgatt
caagccggagctggcaaggtatatattgcaggcggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgcagcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaattg
acagcagaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtgatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattagatttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtggttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgacgcgattattttatatgtttgacaaagagactatg
attgcatctatggggattgggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system